SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g01430

Feature Type:gene_model
Chromosome:Gm08
Start:898774
stop:900025
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g01430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13080AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 75 | chr5:4149928-4151019 REVERSE LENGTH=145 SoyBaseE_val: 1.00E-48ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0032107GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of response to nutrient levels SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0043620GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA-dependent transcription in response to stress SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_A7LHG8UniRef Annotation by Michelle Graham. Most informative UniRef hit: WRKY25 n=1 Tax=Glycine max RepID=A7LHG8_SOYBN SoyBaseE_val: 2.00E-90ISS
UniRef100_I1KP65UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KP65_SOYBN SoyBaseE_val: 1.00E-104ISS

Proteins Associated with Glyma08g01430
LocusGene SymbolProtein Name
WRKY25 WRKY Transcription Factor

Expression Patterns of Glyma08g01430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g01430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g011300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g01430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g01430
>Glyma08g01430.1   sequence type=CDS   gene model=Glyma08g01430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAACATCAAGTGTTGTCCCCTATTTCATCTTCATCATCTACTTCTCCATCTGACTTTAAACTTGGTGATCACAATTCTAATGCTCATGTCAAAAAGGCAGGTTTATTAAAAACTCAAAGGCCAAGCCTGAAAGGTGGCAAAGAAATCAAGCAGCACAGATATGCATTTCAAACAAGGAGTCATGTTGATATACTGGATGATGGGTACCGGTGGAGAAAGTATGGGGAGAAGTCCGTGAAAAACAATAAATTTCCTAGAAATTACTACAGATGTTCTTATCGAGGTTGCAATGTGAAGAAACAAATCCAACGCCATTCCAAAGACGAAGAGATTGTGGTAACAACCTATGAAGGGATACATATTCATCCTGTGGAGAAGTCAACTGAAAGCTTCGAGCAGATATTGAGAAACCATCACATATACAGCCTAACTCTATAA
Predicted protein sequences of Glyma08g01430
>Glyma08g01430.1   sequence type=predicted peptide   gene model=Glyma08g01430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKHQVLSPISSSSSTSPSDFKLGDHNSNAHVKKAGLLKTQRPSLKGGKEIKQHRYAFQTRSHVDILDDGYRWRKYGEKSVKNNKFPRNYYRCSYRGCNVKKQIQRHSKDEEIVVTTYEGIHIHPVEKSTESFEQILRNHHIYSLTL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo