SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g01151): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g01151): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g01151

Feature Type:gene_model
Chromosome:Gm08
Start:663805
stop:665697
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30600AT Annotation by Michelle Graham. TAIR10: Subtilase family protein | chr1:10841341-10844906 REVERSE LENGTH=832 SoyBaseE_val: 1.00E-81ISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0043086GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
GO:0042802GO-mf Annotation by Michelle Graham. GO Molecular Function: identical protein binding SoyBaseN/AISS
PTHR10795Panther SUBTILISIN/KEXIN-RELATED SERINE PROTEASE JGI ISS
PTHR10795:SF17Panther gb def: possible protease [sinorhizobium meliloti] JGI ISS
PF00082PFAM Subtilase family JGI ISS
UniRef100_B9SV70UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidase, putative n=1 Tax=Ricinus communis RepID=B9SV70_RICCO SoyBaseE_val: 7.00E-86ISS
UniRef100_UPI00023385B2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023385B2 related cluster n=1 Tax=unknown RepID=UPI00023385B2 SoyBaseE_val: 5.00E-107ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g01151 not represented in the dataset

Glyma08g01151 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g008500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g01151.1   sequence type=CDS   gene model=Glyma08g01151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTCCATTTCAATCTTTTACAGCATTGCCATTTACAAGGCACTATACAAGAGATTTGGAGGATTTGCAGCGGATGTTGTTGCAGCTATTGACCAGGCAGCTCAGGATAGGGTTGACATAATATGCTTGTCAATCACTCCTAATAGGCATCCTTCTGGTATTGCAACTTTCTTCAATCCAATAGATATGGCATTGCTATCAGCTGCGAAAGCTGGTATTTTTGTAGTGCAAGCTGCTGGCAATACTGGACCATCACCTATGAGCATGCCCTCCTTCAGTCCATGGATCTTTACTGTTGGTGCCACCTCTCATGATCGAGTTTATATCAACTCCCTATGTCTTGGAAATAATGTGACTATACCTGGTGTTGGACTTGCACCTGGCACATACGAGAACACATTGTTTAAATTGATTCATGCAAGACATGCTTTGAACAAAAACACAACAGTTACTGATGATATGTATATTGGTGAGTGTCAAGATTTAAGTAAGTTCAGTCAGGATTTGGTCCAGGGCAACAAATGCTAA

>Glyma08g01151.1   sequence type=predicted peptide   gene model=Glyma08g01151   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHSISIFYSIAIYKALYKRFGGFAADVVAAIDQAAQDRVDIICLSITPNRHPSGIATFFNPIDMALLSAAKAGIFVVQAAGNTGPSPMSMPSFSPWIFTVGATSHDRVYINSLCLGNNVTIPGVGLAPGTYENTLFKLIHARHALNKNTTVTDDMYIGECQDLSKFSQDLVQGNKC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo