SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g01081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g01081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g01081

Feature Type:gene_model
Chromosome:Gm08
Start:618346
stop:621156
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G61980AT Annotation by Michelle Graham. TAIR10: ARF-GAP domain 1 | chr5:24894472-24899178 FORWARD LENGTH=828 SoyBaseE_val: 1.00E-21ISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0048610GO-bp Annotation by Michelle Graham. GO Biological Process: cellular process involved in reproduction SoyBaseN/AISS
GO:0048868GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0030139GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endocytic vesicle SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23180Panther CENTAURIN/ARF JGI ISS
PTHR23180:SF22Panther GCN4-COMPLEMENTING PROTEIN JGI ISS
PF00023PFAM Ankyrin repeat JGI ISS
UniRef100_G7LIT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor GTPase-activating protein n=1 Tax=Medicago truncatula RepID=G7LIT7_MEDTR SoyBaseE_val: 4.00E-34ISS
UniRef100_UPI00023399C7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023399C7 related cluster n=1 Tax=unknown RepID=UPI00023399C7 SoyBaseE_val: 1.00E-64ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g01081 not represented in the dataset

Glyma08g01081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g01081.1   sequence type=CDS   gene model=Glyma08g01081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGAAAAACTGAGCTCCTGTACAAGATAGATATTTTCCAACTTCGAATAACATATTCTGAGAAAATATTTATTCCCCGGACAAAGAAAAACCATCCTGTCTTTTCACGGGCACAACTGGTGCAGGAAAGCATCTGTGGCAATGATAAGAAAGCAGTGTACCAGCATATTGTCAAGTCGGATTTTGACATCAATGCCATCGGTTGGCAAGCATCGTCTGATGACTCTTTCGACACGGCTTCTTCAAATAATTTAAACATTGCATCTCAAAGTGAAAATCAGCCCATTGAGGCCATACAAGATGGTTCTAGCGTGCTTCACCTTGCATGCCAAACTAGTGACGTTGGCATGGTGGAGCAGCTCCTACAACATGGGGCAAATATAAATGCTTGTGATTCTAGAGGTCGGGCACCACTACATACATTATTGTATTACTAA

>Glyma08g01081.1   sequence type=predicted peptide   gene model=Glyma08g01081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRKTELLYKIDIFQLRITYSEKIFIPRTKKNHPVFSRAQLVQESICGNDKKAVYQHIVKSDFDINAIGWQASSDDSFDTASSNNLNIASQSENQPIEAIQDGSSVLHLACQTSDVGMVEQLLQHGANINACDSRGRAPLHTLLYY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo