Glyma08g01081 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g01081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g01081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g01081

Feature Type:	gene_model
Chromosome:	Gm08
Start:	618346
stop:	621156
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g01081

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G61980	AT	Annotation by Michelle Graham. TAIR10: ARF-GAP domain 1 \| chr5:24894472-24899178 FORWARD LENGTH=828	SoyBase	E_val: 1.00E-21	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0048610	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular process involved in reproduction	SoyBase	N/A	ISS
GO:0048868	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube development	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0030139	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endocytic vesicle	SoyBase	N/A	ISS
GO:0005543	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipid binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR23180	Panther	CENTAURIN/ARF	JGI		ISS
PTHR23180:SF22	Panther	GCN4-COMPLEMENTING PROTEIN	JGI		ISS
PF00023	PFAM	Ankyrin repeat	JGI		ISS
UniRef100_G7LIT7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor GTPase-activating protein n=1 Tax=Medicago truncatula RepID=G7LIT7_MEDTR	SoyBase	E_val: 4.00E-34	ISS
UniRef100_UPI00023399C7	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023399C7 related cluster n=1 Tax=unknown RepID=UPI00023399C7	SoyBase	E_val: 1.00E-64	ISS

Expression Patterns of Glyma08g01081

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g01081 not represented in the dataset	Glyma08g01081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g01081 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g01081

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g01081

Limit To All Plant Sequences

>Glyma08g01081.1   sequence type=CDS   gene model=Glyma08g01081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGAAAAACTGAGCTCCTGTACAAGATAGATATTTTCCAACTTCGAATAACATATTCTGAGAAAATATTTATTCCCCGGACAAAGAAAAACCATCCTGTCTTTTCACGGGCACAACTGGTGCAGGAAAGCATCTGTGGCAATGATAAGAAAGCAGTGTACCAGCATATTGTCAAGTCGGATTTTGACATCAATGCCATCGGTTGGCAAGCATCGTCTGATGACTCTTTCGACACGGCTTCTTCAAATAATTTAAACATTGCATCTCAAAGTGAAAATCAGCCCATTGAGGCCATACAAGATGGTTCTAGCGTGCTTCACCTTGCATGCCAAACTAGTGACGTTGGCATGGTGGAGCAGCTCCTACAACATGGGGCAAATATAAATGCTTGTGATTCTAGAGGTCGGGCACCACTACATACATTATTGTATTACTAA

Predicted protein sequences of Glyma08g01081

Limit To All Plant Sequences

>Glyma08g01081.1   sequence type=predicted peptide   gene model=Glyma08g01081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRKTELLYKIDIFQLRITYSEKIFIPRTKKNHPVFSRAQLVQESICGNDKKAVYQHIVKSDFDINAIGWQASSDDSFDTASSNNLNIASQSENQPIEAIQDGSSVLHLACQTSDVGMVEQLLQHGANINACDSRGRAPLHTLLYY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain