SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g01000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g01000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g01000

Feature Type:gene_model
Chromosome:Gm08
Start:544435
stop:547777
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13420AT Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein | chr5:4302080-4304212 REVERSE LENGTH=438 SoyBaseE_val: 4.00E-89ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009809GO-bp Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process SoyBaseN/AISS
GO:0033587GO-bp Annotation by Michelle Graham. GO Biological Process: shikimate biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004801GO-mf Annotation by Michelle Graham. GO Molecular Function: sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity SoyBaseN/AISS
PTHR10683Panther TRANSALDOLASE JGI ISS
PF00923PFAM Transaldolase JGI ISS
UniRef100_B4FRC9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transaldolase 2 n=2 Tax=Zea mays RepID=B4FRC9_MAIZE SoyBaseE_val: 1.00E-94ISS
UniRef100_I1KP20UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KP20_SOYBN SoyBaseE_val: 6.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g01000 not represented in the dataset

Glyma08g01000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g007300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g01000.2   sequence type=CDS   gene model=Glyma08g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGACAAAGATCAAAACTACAATTTTGCCGAAAGATTGGTGTCAATTTTGAAAGAGCTATTTCATCCTCAAATGCCTACGATGACCGGTTGAGGGAATTGGTAGAGGCAGGGAAGGACATAGAAAGTGCTTACTGGGAATTGGTTGTCAAGGACATACAGGATGCTTGCAAACTCTTGGAGCCAATTTACAATGAAAAAGATGGGGAAGATGGAAATGTATCTGTTATGGTTTCCCCAAAGCTAGCAAATGATACCAAGGGGACAATTGAGGCAGCAAAGAAACTTCATAAAATGGTTGGAAGTCCTAGTGTTTACATTAAAATTCCTGCCACCGATGAATTCATCTCTTCCATGAAGGAGGTCATTTGTCTGGGGATAAGTGTATATGCCACTCTCATATTCTGCCTCCCTAAATATGAAGCAGTGATTGATGCTTACTTGGATGGCCTTGAGGCTTGTAGCATGACTGATCTCTACAAGGTTTCTAGTGCAGCAGCATTCTACATCAGTAGAGTGGATGCTACACTTGACAAGAAACTTGACCAAATTGGTACCACTGAGGCTCTTGATCTCAAAGGAAAGGGTGCCGTTGCTCAAGCAGTCTTAGCTTACCAACTTTACCAGAAAAAGTTCTCTGGTCCAAGATGGGAACGCTAG

>Glyma08g01000.2   sequence type=predicted peptide   gene model=Glyma08g01000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQRSKLQFCRKIGVNFERAISSSNAYDDRLRELVEAGKDIESAYWELVVKDIQDACKLLEPIYNEKDGEDGNVSVMVSPKLANDTKGTIEAAKKLHKMVGSPSVYIKIPATDEFISSMKEVICLGISVYATLIFCLPKYEAVIDAYLDGLEACSMTDLYKVSSAAAFYISRVDATLDKKLDQIGTTEALDLKGKGAVAQAVLAYQLYQKKFSGPRWER*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo