Report for Sequence Feature Glyma08g00570
Feature Type: gene_model
Chromosome: Gm08
Start: 260920
stop: 262042
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g00570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G08330 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 14 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G17705.1); Has 98 Blast hits to 98 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 98; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:5255384-5256525 REVERSE LENGTH=164
SoyBase E_val: 4.00E-23 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1KNY4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNY4_SOYBN
SoyBase E_val: 3.00E-115 ISS
Expression Patterns of Glyma08g00570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g00570
Paralog Evidence Comments
Glyma05g32940 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g00570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g003400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g00570
Coding sequences of Glyma08g00570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g00570.1 sequence type=CDS gene model=Glyma08g00570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGATCTCCTACGCCGACATGCTCAAGGGATCACATGGATGTCAACAACTTCAACTATCCTCCATTGTCAGAGATGTAAACTACAGCTGTGGCTCGTGTGGTTATGAGCTGAACTTGAACTCCAGCAACCGCAACACTTGTTCTCTCATTGACTCAAAGTCCATAAAGAGAGGCATCATCTCCTTCTTCTCCGTGGATGAGAGCAGGTTCACTCAGATCCAGCAACTTCACTGGCCTTCTTGGATGCCCTTTTTCAACTCCAAGCGCCAAAGAACCAAGCTTTTTTGCCGCAGCTGTGGGAACCACCTTGGCTATGCTTACACTTTGCCCTCTCAATCTCAATCCTGGGATGGCATCTCTGATGATTCCAGAATCTATGATATCAAACTAACCGCTTTGTTACCTTCTTTCTGCGAGGAACCAAGTCAAAAGTTAGAGGATATGGGCAAGTTTGAGACTGCATCTTCCTCCACTCTGGTGTTCTAA
Predicted protein sequences of Glyma08g00570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g00570.1 sequence type=predicted peptide gene model=Glyma08g00570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MISYADMLKGSHGCQQLQLSSIVRDVNYSCGSCGYELNLNSSNRNTCSLIDSKSIKRGIISFFSVDESRFTQIQQLHWPSWMPFFNSKRQRTKLFCRSCGNHLGYAYTLPSQSQSWDGISDDSRIYDIKLTALLPSFCEEPSQKLEDMGKFETASSSTLVF*