SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g00460

Feature Type:gene_model
Chromosome:Gm08
Start:171384
stop:174956
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g00460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09220AT Annotation by Michelle Graham. TAIR10: amino acid permease 2 | chr5:2866867-2868863 FORWARD LENGTH=493 SoyBaseE_val: 0ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015800GO-bp Annotation by Michelle Graham. GO Biological Process: acidic amino acid transport SoyBaseN/AISS
GO:0015804GO-bp Annotation by Michelle Graham. GO Biological Process: neutral amino acid transport SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005887GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0015171GO-mf Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity SoyBaseN/AISS
KOG1303 KOG Amino acid transporters JGI ISS
PTHR22950Panther AMINO ACID TRANSPORTER JGI ISS
PF01490PFAM Transmembrane amino acid transporter protein JGI ISS
UniRef100_G7LEY2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Amino acid permease n=1 Tax=Medicago truncatula RepID=G7LEY2_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1K519UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K519_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g00460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g00460
ParalogEvidenceComments
Glyma05g32810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g00460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g002400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g00460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g00460
>Glyma08g00460.2   sequence type=CDS   gene model=Glyma08g00460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTGAGAACCCTGCAGCCACAACCAACCTTCAAGTTTTTGGCATCGAAGATGATCTGCCTTCGCACTCACAGAATAACTCCAAATGCTATGATGATGATGGCCGTCTCAAACGAACTGGAAATGTTTGGACAGCAAGCAGCAGTGATAGGATCAGGGGTGCTTGGGCCATAGCTCAGCTAGGTGGAGCCAATGTTACGTTCTGTGGAATATTTCAGTACCTGAATCTATTGGGAATTGTAATAGGATACACAATTGCCGCTTCTATTAGCATGAGGGCAATCAAAAGGTCAAACTGTTTCCATAAATCTGGGGGCAAAAACCCATGTCACATGCCAAGCAACCTATACATGATAATTTTTGGCGCAACCGAAATGTTTCTTTCTCAAATTCCCGATTTTGATCAAATATGGTGGCTCTCAACAGTTGCTGCAATCATGTCTTTCACCTATTCCATAATTGGTCTCTCTCTTGGAATTGCCAAAGTTGCAGAAACGGGTCCCTTCAAGGGTGGCCTCACTGGAGTCAGCATTGGACCAGTGTCAGAGACCCAAAAAATATGGAGGACTTCCCAAGCTCTTGGTGACATAGCCTTTGCCTATTCGTATGCTGTGGTTCTCATAGAAATTCAGGACACCATAAAATCTCCACCATCTGAAGCAGAAACAATGAAGAAGGCCACATTGATAAGTATTGCAGTGACCACAACATTTTACATGCTCTGTGGCTGCATGGGGTATGCTGCTTTTGGAGATGCTGCACCTGGGAATCTGCTCACTGGCTTTGGCTTCTATAACCCATATTGGCTTATAGACATTGCAAATGCTGCTATAGTAATTCACCTTGTGGGAGCATACCAAGTGTTTTCCCAACCCATCTTTGCCTTTGTGGAGAAAGAGGTAACACAAAGATGGCCCAACTTTAACAGGGAGTTCAAGATTCCAATTCCTGGTTTCTCCCCATACAAACTAAAGGTGTTTAGATTAGTTTTGAGGACAGTGTTTGTTGTCCTAACAACTGTGATATCAATGTTGCTTCCATTCTTCAATGACATTGTTGGAGTGATTGGGGCATTGGGATTTTGGCCATTAACAGTTTACTTTCCTGTGGAGATGTATATTTCACAGAAGAAGATACCAAAATGGAGTAACAGATGGATTAGTCTCAAAATATTTAGCATGGCCTGCCTCATAGTATCAGTTGTTGCTGCTGTTGGCTCAGTGGCAGGAGTCTTGCTTGACCTTAAGAAATACAAACCATTCCACTCAAACTATTAA
Predicted protein sequences of Glyma08g00460
>Glyma08g00460.2   sequence type=predicted peptide   gene model=Glyma08g00460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPENPAATTNLQVFGIEDDLPSHSQNNSKCYDDDGRLKRTGNVWTASSSDRIRGAWAIAQLGGANVTFCGIFQYLNLLGIVIGYTIAASISMRAIKRSNCFHKSGGKNPCHMPSNLYMIIFGATEMFLSQIPDFDQIWWLSTVAAIMSFTYSIIGLSLGIAKVAETGPFKGGLTGVSIGPVSETQKIWRTSQALGDIAFAYSYAVVLIEIQDTIKSPPSEAETMKKATLISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPYWLIDIANAAIVIHLVGAYQVFSQPIFAFVEKEVTQRWPNFNREFKIPIPGFSPYKLKVFRLVLRTVFVVLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYISQKKIPKWSNRWISLKIFSMACLIVSVVAAVGSVAGVLLDLKKYKPFHSNY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo