SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g00300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g00300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g00300

Feature Type:gene_model
Chromosome:Gm08
Start:68377
stop:71556
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55010AT Annotation by Michelle Graham. TAIR10: phosphoribosylformylglycinamidine cyclo-ligase, chloroplast / phosphoribosyl-aminoimidazole synthetase / AIR synthase (PUR5) | chr3:20386818-20388549 FORWARD LENGTH=389 SoyBaseE_val: 1.00E-176ISS
GO:0006164GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process SoyBaseN/AISS
GO:0006189GO-bp Annotation by Michelle Graham. GO Biological Process: 'de novo' IMP biosynthetic process SoyBaseN/AISS
GO:0006744GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004641GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoribosylformylglycinamidine cyclo-ligase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR10520Panther PHOSPHORIBOSYLAMINE-GLYCINE LIGASE JGI ISS
PF00586PFAM AIR synthase related protein, N-terminal domain JGI ISS
PF02769PFAM AIR synthase related protein, C-terminal domain JGI ISS
UniRef100_I1KNV7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoribosylformylglycinamidine cyclo-ligase n=1 Tax=Glycine max RepID=I1KNV7_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1KNV7UniRef Annotation by Michelle Graham. Best UniRef hit: Phosphoribosylformylglycinamidine cyclo-ligase n=1 Tax=Glycine max RepID=I1KNV7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g00300 not represented in the dataset

Glyma08g00300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma05g32640 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g001000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g00300.1   sequence type=CDS   gene model=Glyma08g00300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCTTCTCAACATGCGCCGAGATATCGCGTTGTTTCGCCGCAGCAACGGCAGCAGCTTCAGCGAAACCTAATTCCGGGAAGTCAAACGGCACCGCCACAACAAGCCTCAGTTTTCTCACTCCAATCGGTCGTTACGGCGCCGTTTCATCAGTGTCGAGGTCGAATAAGACCAACAGAATAGTCGTGGAAGCTACTCAAGGTCTTACTTACAGGGACGCCGGCGTGGACATCGACGCCGGCTCCGAACTCGTGCGCAGGATAGCGAAGATGGCGCCAGGGATTGGAGGCTTCGGCGGTTTATTTCCTCTCGGTGACTCGTACCTCGTTGCTGGTACCGATGGCGTGGGGACAAAGGTGATGCTTGCCTTCGAAACTGGAATTCACGATACTATCGGGATTGACCTGGTTGCGATGAGTGTGAATGACATTGTTACTTCGGGGGCGAAGCCTTTGTTTTTTCTTGATTACTTTGCCACTGGCCACCTTGATGTGAACGTTGCTGAAAAGGTTATAAAAGGCATTGTTGATGGTTGCAAGCAATCTGATTGTGTTCTGTTAGGAGGAGAGACTGCAGAGATGCCTGGTCTCTATAAAGAAGGTGAGTACGATCTTAGTGGCTGTGCAGTTGGCATTGTGAAGAAAGATTCTGTAATCAATGGGTCAGACATTGTTGCTGGTGATATTATTATTGGTCTTCCATCTAGTGGAGTTCACTCTAATGGTTTCTCACTTGTAAGAAGAGTGCTTGCTCAAAGTGGTCTTTCACTGAAAGATCAACTTCCTGGTAGTGATGTTACAATTGCAGAGGCTTTGATGGCCCCAACTGTTATCTATGTTAAACAGGTACTTGACTTAATTAGCAAGGGAGGGGTGAAAGGAATTGCCCACATCACCGGTGGTGGTTTCACAGATAACATACCCCGAGTTTTTCCGGAAGACCTCGGAGCTGTGATATATGATGGGTCATGGGAAGTGCCTGCAGTGTTTAAGTGGCTTCAGGAGGCTGGGAAGATTGAAGACTCTGAGATGAGACGGACTTTTAATATGGGCATAGGGATGATCCTGGTAGTTGGTCCAGAGGCAGCTAATAGAATACTCGAGAACAGAGGTGAAACAGAGAAATTCTACCGCATTGGTGAAATTATAAGCGGCAAGGGAGTGACCTTTAGCTAA

>Glyma08g00300.1   sequence type=predicted peptide   gene model=Glyma08g00300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSFSTCAEISRCFAAATAAASAKPNSGKSNGTATTSLSFLTPIGRYGAVSSVSRSNKTNRIVVEATQGLTYRDAGVDIDAGSELVRRIAKMAPGIGGFGGLFPLGDSYLVAGTDGVGTKVMLAFETGIHDTIGIDLVAMSVNDIVTSGAKPLFFLDYFATGHLDVNVAEKVIKGIVDGCKQSDCVLLGGETAEMPGLYKEGEYDLSGCAVGIVKKDSVINGSDIVAGDIIIGLPSSGVHSNGFSLVRRVLAQSGLSLKDQLPGSDVTIAEALMAPTVIYVKQVLDLISKGGVKGIAHITGGGFTDNIPRVFPEDLGAVIYDGSWEVPAVFKWLQEAGKIEDSEMRRTFNMGIGMILVVGPEAANRILENRGETEKFYRIGEIISGKGVTFS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo