SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g00217): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g00217): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g00217

Feature Type:gene_model
Chromosome:Gm08
Start:1891
stop:11508
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g00217
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G13850AT Annotation by Michelle Graham. TAIR10: glycine-rich RNA-binding protein 2 | chr4:8021314-8022065 FORWARD LENGTH=144 SoyBaseE_val: 7.00E-22ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0031564GO-bp Annotation by Michelle Graham. GO Biological Process: transcription antitermination SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0001072GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding transcription antitermination factor activity SoyBaseN/AISS
GO:0003690GO-mf Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR24011Panther FAMILY NOT NAMED JGI ISS
PTHR24011:SF259Panther JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_G7JUS2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA-binding protein n=1 Tax=Medicago truncatula RepID=G7JUS2_MEDTR SoyBaseE_val: 1.00E-39ISS
UniRef100_UPI000233858EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233858E related cluster n=1 Tax=unknown RepID=UPI000233858E SoyBaseE_val: 4.00E-104ISS

Expression Patterns of Glyma08g00217
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g00217 not represented in the dataset
Glyma08g00217 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g00217 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g00217
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g00217
>Glyma08g00217.1   sequence type=CDS   gene model=Glyma08g00217   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATGTGAAAACGGCTTGTTGTTTCACCCCTAGCCTGCGGAAAATGCTTTATTGTGTTTCGGATATCAATTTAAAGTTCACAGTTATGCGAATAGCCAGTGCATTAGTGAATGGCAGCGCTCTTCATTTCCACTTACCTAGATTTCTATATGTGCGTCATCATTCATCAATCAAGTTGTTTGTCACAGGGCTTTCCTATGATACCAATGAACCGGTTCTGAGAGATGCCTTTGGGCAACATGGTGAAATCATTGAAGTTAAAGTAATATGTGATCATGTGACTGGAAAATCAAGAGGATATGGATTTGTGCGGTTCCTTTCTGAAACTATAGCTGCTGCAACTCACAAAGAAATGAATGGCCAGATACTGGATGGAAGATGCATTCGAGTGAGTTATGCACACAAAGGTGAGCGACTAAGTCTGCCAAACAATGCATAA
Predicted protein sequences of Glyma08g00217
>Glyma08g00217.1   sequence type=predicted peptide   gene model=Glyma08g00217   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYVKTACCFTPSLRKMLYCVSDINLKFTVMRIASALVNGSALHFHLPRFLYVRHHSSIKLFVTGLSYDTNEPVLRDAFGQHGEIIEVKVICDHVTGKSRGYGFVRFLSETIAAATHKEMNGQILDGRCIRVSYAHKGERLSLPNNA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo