|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G13850 | AT | Annotation by Michelle Graham. TAIR10: glycine-rich RNA-binding protein 2 | chr4:8021314-8022065 FORWARD LENGTH=144 | SoyBase | E_val: 7.00E-22 | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006970 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to osmotic stress | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009631 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cold acclimation | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0031564 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription antitermination | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0001072 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding transcription antitermination factor activity | SoyBase | N/A | ISS |
| GO:0003690 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: double-stranded DNA binding | SoyBase | N/A | ISS |
| GO:0003697 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24011:SF259 | Panther | JGI | ISS | ||
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_G7JUS2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glycine-rich RNA-binding protein n=1 Tax=Medicago truncatula RepID=G7JUS2_MEDTR | SoyBase | E_val: 1.00E-39 | ISS |
| UniRef100_UPI000233858E | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233858E related cluster n=1 Tax=unknown RepID=UPI000233858E | SoyBase | E_val: 4.00E-104 | ISS |
|
Glyma08g00217 not represented in the dataset |
Glyma08g00217 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g00217.1 sequence type=CDS gene model=Glyma08g00217 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTATGTGAAAACGGCTTGTTGTTTCACCCCTAGCCTGCGGAAAATGCTTTATTGTGTTTCGGATATCAATTTAAAGTTCACAGTTATGCGAATAGCCAGTGCATTAGTGAATGGCAGCGCTCTTCATTTCCACTTACCTAGATTTCTATATGTGCGTCATCATTCATCAATCAAGTTGTTTGTCACAGGGCTTTCCTATGATACCAATGAACCGGTTCTGAGAGATGCCTTTGGGCAACATGGTGAAATCATTGAAGTTAAAGTAATATGTGATCATGTGACTGGAAAATCAAGAGGATATGGATTTGTGCGGTTCCTTTCTGAAACTATAGCTGCTGCAACTCACAAAGAAATGAATGGCCAGATACTGGATGGAAGATGCATTCGAGTGAGTTATGCACACAAAGGTGAGCGACTAAGTCTGCCAAACAATGCATAA
>Glyma08g00217.1 sequence type=predicted peptide gene model=Glyma08g00217 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MYVKTACCFTPSLRKMLYCVSDINLKFTVMRIASALVNGSALHFHLPRFLYVRHHSSIKLFVTGLSYDTNEPVLRDAFGQHGEIIEVKVICDHVTGKSRGYGFVRFLSETIAAATHKEMNGQILDGRCIRVSYAHKGERLSLPNNA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||