|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G10310 | AT | Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr1:3381733-3383874 REVERSE LENGTH=242 | SoyBase | E_val: 2.00E-16 | ISS |
| GO:0000038 | GO-bp | Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process | SoyBase | N/A | ISS |
| GO:0006760 | GO-bp | Annotation by Michelle Graham. GO Biological Process: folic acid-containing compound metabolic process | SoyBase | N/A | ISS |
| GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0042335 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cuticle development | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016616 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | SoyBase | N/A | ISS |
| UniRef100_B9SPD4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Short-chain dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9SPD4_RICCO | SoyBase | E_val: 3.00E-14 | ISS |
| UniRef100_I1JK52 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JK52_SOYBN | SoyBase | E_val: 5.00E-17 | ISS |
|
Glyma07g40280 not represented in the dataset |
Glyma07g40280 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g272900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g40280.1 sequence type=CDS gene model=Glyma07g40280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAGCGATAATAGTGAACATGGCTTGTGGATGGGGAAGGTGGTGGGCGATAAAAGGGCTGAGCAAGTCTGTGGCAAAAGACATACTCTCCTCTTGCTTTGGTGCTTCTGCTTCTCTCTATCAAGCACCGCTGGCTGCATTCATGATTCTCAATCTCACTCCAGCTGACAATAGTGCTTCTCTCACTGTCTGA
>Glyma07g40280.1 sequence type=predicted peptide gene model=Glyma07g40280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEAIIVNMACGWGRWWAIKGLSKSVAKDILSSCFGASASLYQAPLAAFMILNLTPADNSASLTV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||