SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g40165

Feature Type:gene_model
Chromosome:Gm07
Start:44441990
stop:44447948
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g40165
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G02470AT Annotation by Michelle Graham. TAIR10: alfin-like 6 | chr2:652837-654621 FORWARD LENGTH=256 SoyBaseE_val: 2.00E-133ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0035064GO-mf Annotation by Michelle Graham. GO Molecular Function: methylated histone residue binding SoyBaseN/AISS
KOG1632 KOG Uncharacterized PHD Zn-finger protein JGI ISS
PTHR23123Panther PHD/F-BOX CONTAINING PROTEIN JGI ISS
PF00628PFAM PHD-finger JGI ISS
PF12165PFAM Domain of unknown function (DUF3594) JGI ISS
UniRef100_I1KNQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNQ7_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q06A75UniRef Annotation by Michelle Graham. Most informative UniRef hit: PHD5 n=1 Tax=Glycine max RepID=Q06A75_SOYBN SoyBaseE_val: 8.00E-162ISS

Expression Patterns of Glyma07g40165
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g40165 not represented in the dataset
Glyma07g40165 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g40165
ParalogEvidenceComments
Glyma17g00630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g40165 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g271400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g40165
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g40165
>Glyma07g40165.1   sequence type=CDS   gene model=Glyma07g40165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGGAGTACCGCACCCAATACCCAGAACTGTCGAAGAGGTTTTCACCGATTTTAAGGGCAGACGCGCTGGTTTGATTAAGGCCCTCACTACTGACGTTGAAAAGTTTTACCAGCAGTGCGATCCCGAGAAGGAGAATTTGTGTCTATATGGGTTTCCAAATGAAACATGGGAAGTGAATTTGCCTGTTGAGGAAGTGCCTCCTGAACTTCCTGAGCCAGCATTAGGTATAAACTTTGCCAGGGACGGCATGCAAGAGAAGGACTGGCTATCACTGGTTGCAGTTCACAGTGACTCATGGCTGCTTGCTGTTGCTTTCTATTTTGGTGCCCGCTTTGGATTTGGTAAGAATGAAAGGAAAAGGCTTTTTCAGATGATAAATGATCTGCCGACAATCTTCGAACTTGTGACAGGAAGTGCTAAGCAATTAAAGGATCAACCAGCTGCTCACAACAATGGTAGCAAATGCAAATCAAGTGGAAAGTCCCATCAGTCTGAGTCTCAGGCCAAGGGGATGAAGATGTCTGCACCACCCAAAGAAGAGGATGAGAGTGGAGAAGAAGAAGAAGATGATGAACAGGGTGCAACATGTGGTGCTTGCGGTGATAATTATGGCACTGATGAATTCTGGATCTGTTGTGATATGTGTGAAAGATGGTTCCATGGTAAATGTGTTAAAATTACTCCTGCTAAGGCTGAGCACATCAAGCAATACAAGTGCCCTAGCTGCAGTAACAAGAGGGTTAGAGTTTGA
Predicted protein sequences of Glyma07g40165
>Glyma07g40165.1   sequence type=predicted peptide   gene model=Glyma07g40165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGVPHPIPRTVEEVFTDFKGRRAGLIKALTTDVEKFYQQCDPEKENLCLYGFPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKRLFQMINDLPTIFELVTGSAKQLKDQPAAHNNGSKCKSSGKSHQSESQAKGMKMSAPPKEEDESGEEEEDDEQGATCGACGDNYGTDEFWICCDMCERWFHGKCVKITPAKAEHIKQYKCPSCSNKRVRV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo