Report for Sequence Feature Glyma07g40165
Feature Type: gene_model
Chromosome: Gm07
Start: 44441990
stop: 44447948
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g40165
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G02470 AT
Annotation by Michelle Graham. TAIR10: alfin-like 6 | chr2:652837-654621 FORWARD LENGTH=256
SoyBase E_val: 2.00E-133 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
GO:0035064 GO-mf
Annotation by Michelle Graham. GO Molecular Function: methylated histone residue binding
SoyBase N/A ISS
KOG1632
KOG
Uncharacterized PHD Zn-finger protein
JGI ISS
PTHR23123 Panther
PHD/F-BOX CONTAINING PROTEIN
JGI ISS
PF00628 PFAM
PHD-finger
JGI ISS
PF12165 PFAM
Domain of unknown function (DUF3594)
JGI ISS
UniRef100_I1KNQ7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNQ7_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q06A75 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: PHD5 n=1 Tax=Glycine max RepID=Q06A75_SOYBN
SoyBase E_val: 8.00E-162 ISS
Expression Patterns of Glyma07g40165
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g40165
Paralog Evidence Comments
Glyma17g00630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g40165 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g271400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g40165
Coding sequences of Glyma07g40165
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g40165.1 sequence type=CDS gene model=Glyma07g40165 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGGAGTACCGCACCCAATACCCAGAACTGTCGAAGAGGTTTTCACCGATTTTAAGGGCAGACGCGCTGGTTTGATTAAGGCCCTCACTACTGACGTTGAAAAGTTTTACCAGCAGTGCGATCCCGAGAAGGAGAATTTGTGTCTATATGGGTTTCCAAATGAAACATGGGAAGTGAATTTGCCTGTTGAGGAAGTGCCTCCTGAACTTCCTGAGCCAGCATTAGGTATAAACTTTGCCAGGGACGGCATGCAAGAGAAGGACTGGCTATCACTGGTTGCAGTTCACAGTGACTCATGGCTGCTTGCTGTTGCTTTCTATTTTGGTGCCCGCTTTGGATTTGGTAAGAATGAAAGGAAAAGGCTTTTTCAGATGATAAATGATCTGCCGACAATCTTCGAACTTGTGACAGGAAGTGCTAAGCAATTAAAGGATCAACCAGCTGCTCACAACAATGGTAGCAAATGCAAATCAAGTGGAAAGTCCCATCAGTCTGAGTCTCAGGCCAAGGGGATGAAGATGTCTGCACCACCCAAAGAAGAGGATGAGAGTGGAGAAGAAGAAGAAGATGATGAACAGGGTGCAACATGTGGTGCTTGCGGTGATAATTATGGCACTGATGAATTCTGGATCTGTTGTGATATGTGTGAAAGATGGTTCCATGGTAAATGTGTTAAAATTACTCCTGCTAAGGCTGAGCACATCAAGCAATACAAGTGCCCTAGCTGCAGTAACAAGAGGGTTAGAGTTTGA
Predicted protein sequences of Glyma07g40165
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g40165.1 sequence type=predicted peptide gene model=Glyma07g40165 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGVPHPIPRTVEEVFTDFKGRRAGLIKALTTDVEKFYQQCDPEKENLCLYGFPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKRLFQMINDLPTIFELVTGSAKQLKDQPAAHNNGSKCKSSGKSHQSESQAKGMKMSAPPKEEDESGEEEEDDEQGATCGACGDNYGTDEFWICCDMCERWFHGKCVKITPAKAEHIKQYKCPSCSNKRVRV*