SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g39936

Feature Type:gene_model
Chromosome:Gm07
Start:44285601
stop:44290141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g39936
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26570AT Annotation by Michelle Graham. TAIR10: calcineurin B-like 3 | chr4:13408608-13409998 REVERSE LENGTH=226 SoyBaseE_val: 3.00E-146ISS
GO:0005513GO-bp Annotation by Michelle Graham. GO Biological Process: detection of calcium ion SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0055075GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion homeostasis SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0034 KOG Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein JGI ISS
PTHR23056Panther CALCINEURIN B JGI ISS
PTHR23056:SF3Panther CALCINEURIN B JGI ISS
UniRef100_B0I559UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcineurin B-like protein n=1 Tax=Phaseolus vulgaris RepID=B0I559_PHAVU SoyBaseE_val: 3.00E-161ISS
UniRef100_I1KNM7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNM7_SOYBN SoyBaseE_val: 7.00E-164ISS

Expression Patterns of Glyma07g39936
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g39936 not represented in the dataset
Glyma07g39936 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g39936
ParalogEvidenceComments
Glyma17g00830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g39936 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g269200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g39936
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g39936
>Glyma07g39936.1   sequence type=CDS   gene model=Glyma07g39936   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCAGTGCCTAGACGGATTAAAGCATTTGTGTGCTGCTCTGATAAATTGTTGTGATGCTGATTCGTCAAAGCAACCTACAGGTTTAGAAAATCCTGAAGTTCTTGCAAGAGAGACCGTGTTTAGTGTAAGTGAGATTGAAGCACTGTATGAATTGTTCAAGAAGATCAGCAGTGCAGTGATTGATGACGGACTAATTAATAAGGAAGAATTTCAGTTGGCATTGTTCAAGACGAACAAGAAAGAGAGCTTATTTGCAGATAGGGTGTTTGACTTGTTTGATACAAAGCACAATGGGATACTTGATTTTGAAGAGTTTGCACGTGCTCTCTCTGTCTTTCATCCCAATGCACCAATTGATGATAAGATTGAGTTTTCATTCCAATTGTATGATCTCAAACAACAAGGTTTTATTGAAAGACAGGAGGTAAAACAAATGGTAGTGGCCACTCTAGCCGAATCTGGCATGAATCTTTCAGATGATGTGATCGAAAGTATTATTGACAAGACATTTGAGGAAGCTGATACCAAACATGATGGGAAGATTGACAAGGAAGAATGGCGAAACCTTGTCTTACAGCATCCATCCCTTCTGAAAAATATGACTCTTCAGTATCTCAAAGATATCACTACTACATTTCCCAGTTTTGTTTTTCACTCACAAGTTGATGATACTTGA
Predicted protein sequences of Glyma07g39936
>Glyma07g39936.1   sequence type=predicted peptide   gene model=Glyma07g39936   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVQCLDGLKHLCAALINCCDADSSKQPTGLENPEVLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILDFEEFARALSVFHPNAPIDDKIEFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRNLVLQHPSLLKNMTLQYLKDITTTFPSFVFHSQVDDT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo