Report for Sequence Feature Glyma07g39820
Feature Type: gene_model
Chromosome: Gm07
Start: 44184210
stop: 44186882
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g39820
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G47670 AT
Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit B6 | chr5:19315061-19315975 FORWARD LENGTH=234
SoyBase E_val: 4.00E-75 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009738 GO-bp
Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway
SoyBase N/A ISS
GO:0045893 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0033613 GO-mf
Annotation by Michelle Graham. GO Molecular Function: activating transcription factor binding
SoyBase N/A ISS
GO:0043565 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding
SoyBase N/A ISS
KOG0869
KOG
CCAAT-binding factor, subunit A (HAP3)
JGI ISS
PTHR11064 Panther
TATA-BINDING PROTEIN-ASSOCIATED PHOSPHOPROTEIN
JGI ISS
PTHR11064:SF9 Panther
CCAAT-BINDING TRANSCRIPTION FACTOR SUBUNIT A
JGI ISS
PF00808 PFAM
Histone-like transcription factor (CBF/NF-Y) and archaeal histone
JGI ISS
UniRef100_B5KMS8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor LEC1-A n=1 Tax=Glycine max RepID=B5KMS8_SOYBN
SoyBase E_val: 6.00E-168 ISS
UniRef100_B5KMS8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Transcription factor LEC1-A n=1 Tax=Glycine max RepID=B5KMS8_SOYBN
SoyBase E_val: 6.00E-168 ISS
Expression Patterns of Glyma07g39820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g39820
Paralog Evidence Comments
Glyma17g00950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g39820 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g268100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g39820
Coding sequences of Glyma07g39820
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g39820.1 sequence type=CDS gene model=Glyma07g39820 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAACTGGAGGCTTTCATGGCTACCGCAAGCTCCCCAACACAACCTCTGGGTTGAAGCTGTCAGTGTCAGACATGAACATGAACATGAGGCAGCAGCAGGTAGCATCATCAGATCAGAACTGCAGCAACCACAGTGCAGCAGGAGAGGAGAACGAATGCACGGTGAGGGAGCAAGACAGGTTCATGCCAATCGCTAACGTGATACGGATCATGCGCAAGATTCTCCCTCCACACGCAAAAATCTCCGATGATGCAAAGGAGACAATCCAAGAGTGCGTGTCGGAGTACATCAGCTTCATCACCGGGGAGGCCAACGAGCGTTGCCAGAGGGAGCAGCGCAAGACCATAACCGCAGAGGACGTGCTTTGGGCAATGAGTAAGCTTGGATTCGACGACTACATCGAACCGTTAACCATGTACCTTCACCGCTACCGTGAGCTGGAGGGTGACCGCACCTCTATGAGGGGTGAACCGCTCGGGAAGAGGACTGTGGAATATGCCACGCTTGCTACTGCTTTTGTGCCGCCACCCTTTCATCACCACAATGGCTACTTTGGTGCTGCCATGCCCATGGGGACTTACGTTAGGGAAACGCCACCAAATGCTGCGTCATCTCATCACCATCATGGAATCTCCAATGCTCATGAACCAAATGCTCGCTCCATATAA
Predicted protein sequences of Glyma07g39820
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g39820.1 sequence type=predicted peptide gene model=Glyma07g39820 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
METGGFHGYRKLPNTTSGLKLSVSDMNMNMRQQQVASSDQNCSNHSAAGEENECTVREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTMYLHRYRELEGDRTSMRGEPLGKRTVEYATLATAFVPPPFHHHNGYFGAAMPMGTYVRETPPNAASSHHHHGISNAHEPNARSI*