SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g39440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g39440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g39440

Feature Type:gene_model
Chromosome:Gm07
Start:43918537
stop:43922761
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G03960AT Annotation by Michelle Graham. TAIR10: Phosphotyrosine protein phosphatases superfamily protein | chr4:1887673-1889000 FORWARD LENGTH=198 SoyBaseE_val: 4.00E-95ISS
GO:0043407GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of MAP kinase activity SoyBaseN/AISS
GO:1900424GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response to bacterium SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004721GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity SoyBaseN/AISS
GO:0004725GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity SoyBaseN/AISS
GO:0016791GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activity SoyBaseN/AISS
KOG1572 KOG Predicted protein tyrosine phosphatase JGI ISS
PF03162PFAM Tyrosine phosphatase family JGI ISS
UniRef100_G7JKG2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Tyrosine specific protein phosphatase family protein n=1 Tax=Medicago truncatula RepID=G7JKG2_MEDTR SoyBaseE_val: 4.00E-117ISS
UniRef100_I1KNI1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNI1_SOYBN SoyBaseE_val: 1.00E-138ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g39440 not represented in the dataset

Glyma07g39440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g264400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g39440.1   sequence type=CDS   gene model=Glyma07g39440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTTGACTGCTCTAACGGCCAGGCTCCTCTCGCCGCCGATGTTTCTCCGCCGCAGGAAGACGGCTCCGAGGAGGAGATATTCGTGCCGCCGCTCAACTTCGCCATGGTCGACAACGGCATTTTTAGGGCTGGCTTTCCCGATTCCGCCAACTTCGGATTCCTGAAATCACTCCGTCTCCGTTCCGTAATGTGTTTGTGCCCTGAACCGTATCCCGAAACGACTTCGGAATTTTTGAAGGCCAACGGAATAAGGCTTTATCAGTTCGGGATCGATGGCTGTAAGGAACCCTTTGTCAACATCCCAAATGATACAATTCGTGAAGCTTTGAAAGTAGCCCTCGATGTTAGGAATCACCCCCTGCTGATTCATTGTAAACGAGGGAAGCATCGCACTGGTTGTCTTGTGGGATGCATAAGAAGATTGCAGAGGTGGTGTCTATCATCTGTTTTTGATGAGTACCAAAGGTTTGCAGGTGCCAAAGCTAGAGTGTCAGACCAGAGGTTCATCGAATTGTTTGATATCTCTTGTTTGAAGCACCACCCACTGTCATTTTCATGCTCCAAAAAATAG

>Glyma07g39440.1   sequence type=predicted peptide   gene model=Glyma07g39440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLDCSNGQAPLAADVSPPQEDGSEEEIFVPPLNFAMVDNGIFRAGFPDSANFGFLKSLRLRSVMCLCPEPYPETTSEFLKANGIRLYQFGIDGCKEPFVNIPNDTIREALKVALDVRNHPLLIHCKRGKHRTGCLVGCIRRLQRWCLSSVFDEYQRFAGAKARVSDQRFIELFDISCLKHHPLSFSCSKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo