SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g39280

Feature Type:gene_model
Chromosome:Gm07
Start:43787178
stop:43787552
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g39280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11925AT Annotation by Michelle Graham. TAIR10: Stigma-specific Stig1 family protein | chr1:4026195-4026617 REVERSE LENGTH=140 SoyBaseE_val: 5.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04885PFAM Stigma-specific protein, Stig1 JGI ISS
UniRef100_I1KNG4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KNG4_SOYBN SoyBaseE_val: 4.00E-74ISS
UniRef100_O65387UniRef Annotation by Michelle Graham. Most informative UniRef hit: F12F1.21 protein n=2 Tax=Arabidopsis thaliana RepID=O65387_ARATH SoyBaseE_val: 2.00E-26ISS

Expression Patterns of Glyma07g39280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g39280
ParalogEvidenceComments
Glyma17g01460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g39280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g262900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g39280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g39280
>Glyma07g39280.1   sequence type=CDS   gene model=Glyma07g39280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACCCTCTTCCTTCTAGCCATGCTAATGGCTTTGGCTGTTTTTGTGTCAGCAATATCTCCCGGAAGTGAAAAACCAAAAGGGAAAATTAATCGATTTCTTTCTGACAGGGTGGTGCTGACATGTGAAAAATACCCTGAGGTATGCCTCATTAAAGGAAGCGCAGGATCTGATTGCTGCAAGAACAAATGTGTCAACCTTTCCACAGATGTCTCCAATTGTGGGAAATGTGGAAAGAAATGTAGCTATGGTAAGATATGTTGCGAAGGTAAGTGCGTGAATCCTCGGACTAACGAGAAGCATTGTGGGAAATGTGACAACAAGTGCAACTCTGAGAGTTCATGTATCTATGGAATGTGTAGCTACGCGTAG
Predicted protein sequences of Glyma07g39280
>Glyma07g39280.1   sequence type=predicted peptide   gene model=Glyma07g39280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTLFLLAMLMALAVFVSAISPGSEKPKGKINRFLSDRVVLTCEKYPEVCLIKGSAGSDCCKNKCVNLSTDVSNCGKCGKKCSYGKICCEGKCVNPRTNEKHCGKCDNKCNSESSCIYGMCSYA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo