SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g38900

Feature Type:gene_model
Chromosome:Gm07
Start:43531335
stop:43532814
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g38900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21780AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:11567213-11567560 FORWARD LENGTH=115 SoyBaseE_val: 3.00E-18ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KNB7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNB7_SOYBN SoyBaseE_val: 7.00E-77ISS

Expression Patterns of Glyma07g38900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g38900
ParalogEvidenceComments
Glyma17g01840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g38900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g259100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g38900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g38900
>Glyma07g38900.2   sequence type=CDS   gene model=Glyma07g38900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATATAAAAGCAGTGTCACTGCCATTTCCATCAAAACCATACATCTAGATAGAATGGCTGCTCCTACTCCAGTTGCTATTGGCACAAGGGGCACAATTGGATCTCTTGTAAAGAAGGAAATTGAATACTTCTCCATGTTTGAGTTGGGGAACTCACAGAGGCCTCAGCCACACTTTGTGAACATTGTTTCTGGAAGAGGCTATTCCACTTCCAGGTCAAGTTTCTGGGTCTTGCTAATGACAGGGAAGAGGAGGAAGCGAAGAGATAACAATGTGTTTCTCCCAAAAATGTGTTCGGTTGCTGAAGTGGTAGAAAGCAATAAGTGGAACAGGGTTCCTGGTTACAGCTACAGGATCCTCAAGGATGATATCAACAACTTTCAGCTCTGA
Predicted protein sequences of Glyma07g38900
>Glyma07g38900.2   sequence type=predicted peptide   gene model=Glyma07g38900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKYKSSVTAISIKTIHLDRMAAPTPVAIGTRGTIGSLVKKEIEYFSMFELGNSQRPQPHFVNIVSGRGYSTSRSSFWVLLMTGKRRKRRDNNVFLPKMCSVAEVVESNKWNRVPGYSYRILKDDINNFQL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo