SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g38830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g38830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g38830

Feature Type:gene_model
Chromosome:Gm07
Start:43486645
stop:43488710
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61800AT Annotation by Michelle Graham. TAIR10: glucose-6-phosphate/phosphate translocator 2 | chr1:22824527-22826459 FORWARD LENGTH=388 SoyBaseE_val: 3.00E-175ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009643GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic acclimation SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0010109GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of photosynthesis SoyBaseN/AISS
GO:0015712GO-bp Annotation by Michelle Graham. GO Biological Process: hexose phosphate transport SoyBaseN/AISS
GO:0015713GO-bp Annotation by Michelle Graham. GO Biological Process: phosphoglycerate transport SoyBaseN/AISS
GO:0015714GO-bp Annotation by Michelle Graham. GO Biological Process: phosphoenolpyruvate transport SoyBaseN/AISS
GO:0015760GO-bp Annotation by Michelle Graham. GO Biological Process: glucose-6-phosphate transport SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0035436GO-bp Annotation by Michelle Graham. GO Biological Process: triose phosphate transmembrane transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005315GO-mf Annotation by Michelle Graham. GO Molecular Function: inorganic phosphate transmembrane transporter activity SoyBaseN/AISS
GO:0015120GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphoglycerate transmembrane transporter activity SoyBaseN/AISS
GO:0015152GO-mf Annotation by Michelle Graham. GO Molecular Function: glucose-6-phosphate transmembrane transporter activity SoyBaseN/AISS
GO:0015297GO-mf Annotation by Michelle Graham. GO Molecular Function: antiporter activity SoyBaseN/AISS
GO:0071917GO-mf Annotation by Michelle Graham. GO Molecular Function: triose-phosphate transmembrane transporter activity SoyBaseN/AISS
KOG1441 KOG Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter JGI ISS
PTHR11132Panther SOLUTE CARRIER FAMILY 35 JGI ISS
PF00892PFAM EamA-like transporter family JGI ISS
PF03151PFAM Triose-phosphate Transporter family JGI ISS
UniRef100_B9RXP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glucose-6-phosphate/phosphate translocator 2, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9RXP8_RICCO SoyBaseE_val: 0ISS
UniRef100_UPI0002338EE2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338EE2 related cluster n=1 Tax=unknown RepID=UPI0002338EE2 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g38830 not represented in the dataset

Glyma07g38830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g01891 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g38830.2   sequence type=CDS   gene model=Glyma07g38830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTCCTTAGTGAATCATGTTCCAAGGCCTCAACTCTGCACGTTACCTTCTATCCACAATGTTCAACAAACCACCCTCTCTTCCCTCCAACCTCCTTACATTTCATCCACTGAAAACTTTGCATTGTCACCAAAACTCAGAAGAAGGAGGGTTCCAGAGTGCCGGGCCTATGAAGCAGATAGGTCACAGCCACTTGAGCTTAACATTGATGAACAAGCAGGGATAGAAGCGACTCAGAGGATCAAAATTGGTTTGTATTTTGCTACCTGGTGGGCTTTGAATGTGGCCTTCAACATATACAACAAGAAGGTTCTCAATGCCTTTCCTTACCCATGGCTTACTTCCACTTTGTCCCTTGCTGCTGGCTCTCTCATCATGTTAATCTCATGGGCCAACAAGGTTGCTGAGCTCCCAAAACTTGATTTCGAGTTCTGGAAGGCCCTCTTTCCTGTCGCGGTGTTACATACAATTGGGCATGTTGCAGCTACGGTGAGTATGTCCAAAGTTGCAGTTTCATTTACCCACATCATCAAGAGTGCAGAACCTGCATTTAGTGTCCTGGTATCAAGGTTCTTGCTAGGGGAAGCATTCCCTGTGCAAGTTTACCTTTCACTGGTGCCAATTATAGGAGGTTGTGCGCTTGCTGCTGTGACGGAGCTCAATTTCAATATGATCGGGTTTGTGGGGGCTATGATTTCCAATTTGGCCTTTGTCCTTCGGAATATATTCTCAAAGAAGGGAATGAAAGGGATGTCTGTTAGTGGAATGAATTACTATGCTTGTCTTCCTATATTGTCTCTATTGATTCTCACGCCTTTTGCCATTGCTGTGGAGGGCCCAAAGATGTGGGCTGCAGGCTGGCAAACAGCCTTGTCTGAAATTGGTCCCAATTTTGTTTGGTGGGTAGCTGCCCAGAGTGTCTTCTACCACTTGTACAATCAAGTCTCTTACATGTCTCTTGATCAGATTTCTCCCTTAACATTCAGCATAGGGAACACAATGAAGAGAATTCGGTAA

>Glyma07g38830.2   sequence type=predicted peptide   gene model=Glyma07g38830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMSLVNHVPRPQLCTLPSIHNVQQTTLSSLQPPYISSTENFALSPKLRRRRVPECRAYEADRSQPLELNIDEQAGIEATQRIKIGLYFATWWALNVAFNIYNKKVLNAFPYPWLTSTLSLAAGSLIMLISWANKVAELPKLDFEFWKALFPVAVLHTIGHVAATVSMSKVAVSFTHIIKSAEPAFSVLVSRFLLGEAFPVQVYLSLVPIIGGCALAAVTELNFNMIGFVGAMISNLAFVLRNIFSKKGMKGMSVSGMNYYACLPILSLLILTPFAIAVEGPKMWAAGWQTALSEIGPNFVWWVAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRIR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo