SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma07g38520

Feature Type:gene_model
Chromosome:Gm07
Start:43241794
stop:43243395
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59850AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S8 family protein | chr5:24112499-24113084 REVERSE LENGTH=130 SoyBaseE_val: 3.00E-91ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0042545GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1754 KOG 40S ribosomal protein S15/S22 JGI ISS
PTHR11758Panther 30S RIBOSOMAL PROTEIN S8 JGI ISS
PF00410PFAM Ribosomal protein S8 JGI ISS
UniRef100_C6F117UniRef Annotation by Michelle Graham. Best UniRef hit: Putative ribosomal protein S15 n=1 Tax=Glycine max RepID=C6F117_SOYBN SoyBaseE_val: 1.00E-89ISS
UniRef100_I3NML3UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S15C n=3 Tax=Euphorbiaceae RepID=I3NML3_HEVBR SoyBaseE_val: 2.00E-89ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g02200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g255500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g38520.1   sequence type=CDS   gene model=Glyma07g38520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAGGGTTAGTGTGCTGAACGATGCTCTGAAGAGCATGTACAATGCTGAGAAAAGGGGAAAGCGCCAAGTCATGATTCGGCCATCCTCCAAAGTCATTATCAAATTCCTTTTGGTGATGCAGAAGCACGGATACATTGGAGAGTTTGAGTATGTTGATGACCACAGGGCTGGTAAAATCGTGGTTGAATTGAACGGTAGACTGAACAAGTGTGGGGTTATTAGTCCCCGTTTTGATGTCGGCGTCAAAGAGATTGAAGGTTGGACTGCTAGGCTTCTCCCCTCAAGACAGTTTGGGTATATTGTATTGACTACCTCTGCCGGCATCATGGATCACGAAGAAGCTAGGAGAAAAAATGTTGGTGGTAAGGTACTGGGTTTCTTCTACTAG

>Glyma07g38520.1   sequence type=predicted peptide   gene model=Glyma07g38520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo