Glyma07g38485 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g38485

Feature Type:	gene_model
Chromosome:	Gm07
Start:	43203992
stop:	43205299
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g38485

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G18970	AT	Annotation by Michelle Graham. TAIR10: AWPM-19-like family protein \| chr5:6333714-6334539 REVERSE LENGTH=171	SoyBase	E_val: 8.00E-82	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05512	PFAM	AWPM-19-like family	JGI		ISS
UniRef100_Q8LG79	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AWPM-19-like protein n=1 Tax=Arabidopsis thaliana RepID=Q8LG79_ARATH	SoyBase	E_val: 4.00E-79	ISS
UniRef100_UPI0002338ED8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338ED8 related cluster n=1 Tax=unknown RepID=UPI0002338ED8	SoyBase	E_val: 3.00E-114	ISS

Expression Patterns of Glyma07g38485

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g38485 not represented in the dataset	Glyma07g38485 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g38485

Paralog	Evidence	Comments
Glyma17g02250	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g38485 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g255100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g38485

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g38485

Limit To All Plant Sequences

>Glyma07g38485.1   sequence type=CDS   gene model=Glyma07g38485   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCAGGATCCAAATCAGTAGCTTCTATCCTCTTGGTACTGAATCTAGTGTTGTACTTCATTGTGCTTGTTATTGCTTCTTGGGCAGTGAACCATGGGATTCAAAGGTCTGGCGAAACAGCATCTGTTTTGTCCATTCCAGCTCGAATATTTCCAATATATTTCCCAATGGGAAACATGACAACTGGTTTTTTCGTAATTTTCTCTCTCGTTGCTGGTGTTGTGGGATTCACCACCTCACTCACTGGATTGCAAAACATTCTCCAGTGGAATGCTCCCAACTTACATGCAGCAGCTATGTCTTCATTGACTACATGGGCACTCACTCTACTGGCTATGGGATTTGCATGCAAAGAGATTGAACTTGGCTGGACAGACTCCAACCTGCGCACCTTAGAAACGATCACTATAATTGTAAGCGCAACACAACTGTTATGCACGGGAGTTATCCATGTTGGAGTTTCAGAAGTTGTTGCGCAGAGAATGGGAGGAAGAGTATGA

Predicted protein sequences of Glyma07g38485

Limit To All Plant Sequences

>Glyma07g38485.1   sequence type=predicted peptide   gene model=Glyma07g38485   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASGSKSVASILLVLNLVLYFIVLVIASWAVNHGIQRSGETASVLSIPARIFPIYFPMGNMTTGFFVIFSLVAGVVGFTTSLTGLQNILQWNAPNLHAAAMSSLTTWALTLLAMGFACKEIELGWTDSNLRTLETITIIVSATQLLCTGVIHVGVSEVVAQRMGGRV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain