Report for Sequence Feature Glyma07g38090
Feature Type: gene_model
Chromosome: Gm07
Start: 42956389
stop: 42959331
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g38090
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G15630 AT
Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0497) | chr4:8917527-8918683 FORWARD LENGTH=190
SoyBase E_val: 9.00E-53 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0043424 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding
SoyBase N/A ISS
PTHR11615 Panther
NITRATE, FROMATE, IRON DEHYDROGENASE
JGI ISS
PTHR11615:SF58 Panther
INTEGRAL MEMBRANE FAMILY PROTEIN
JGI ISS
PF04535 PFAM
Domain of unknown function (DUF588)
JGI ISS
UniRef100_C6TBD0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: CASP-like protein 6 n=1 Tax=Glycine max RepID=CSPL6_SOYBN
SoyBase E_val: 1.00E-131 ISS
UniRef100_C6TBD0 UniRef
Annotation by Michelle Graham. Best UniRef hit: CASP-like protein 6 n=1 Tax=Glycine max RepID=CSPL6_SOYBN
SoyBase E_val: 1.00E-131 ISS
Expression Patterns of Glyma07g38090
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma07g38090
Paralog Evidence Comments
Glyma17g02610 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g38090 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g251200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g38090
Coding sequences of Glyma07g38090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g38090.1 sequence type=CDS gene model=Glyma07g38090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGGGGTTGAGAGCAAAGAAAGAGAAGTGATGGTGGCAAAACCAGTTGCAGTAGTAGGTGTCTGTGATTTGCTTCTGAGGCTGTTGGCCTTCACAGTTACTCTTGTCGCTGCTATAGTCATTGCGGTCGATAAGCAGACAAAGCTTGTTCCCATCCAGCTTTCAGATTCTTTTCCACCTTTGAACGTTCCTCTTACTGCTAAGTGGCACCAAATGTCTGCCTTTGTGTACTTTCTGGTGACCAATGCAATAGCATGCACGTATGCAGCCATGTCTCTACTCCTTGCCCTCGTAAACAGAGGTAAAAGCAAAGGCTTGTGGACATTGATCGCTGTTCTCGACACATTCATGGTGGCTTTGCTCTTTTCCGGCAACGGCGCCGCTGCGGCAGTCGGTATCCTTGGCTACAAAGGAAACTCTCATGTGAATTGGAACAAGGTGTGCAATGTCTTTGGGAAATTTTGTGATCAAATGGCTGCTTCGATTGGTGTGTCACTGATTGGATCATTAGCATTCCTCTTGCTCGTGGTTATTCCTGTGGTGAGGCTTCATCGGAGAACTTAG
Predicted protein sequences of Glyma07g38090
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g38090.1 sequence type=predicted peptide gene model=Glyma07g38090 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGVESKEREVMVAKPVAVVGVCDLLLRLLAFTVTLVAAIVIAVDKQTKLVPIQLSDSFPPLNVPLTAKWHQMSAFVYFLVTNAIACTYAAMSLLLALVNRGKSKGLWTLIAVLDTFMVALLFSGNGAAAAVGILGYKGNSHVNWNKVCNVFGKFCDQMAASIGVSLIGSLAFLLLVVIPVVRLHRRT*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
