Report for Sequence Feature Glyma07g37760
Feature Type: gene_model
Chromosome: Gm07
Start: 42722567
stop: 42725594
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g37760
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G15780 AT
Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 724 | chr4:8980081-8981697 REVERSE LENGTH=222
SoyBase E_val: 1.00E-139 ISS
GO:0006810 GO-bp
Annotation by Michelle Graham. GO Biological Process: transport
SoyBase N/A ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0048573 GO-bp
Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0016021 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG0859
KOG
Synaptobrevin/VAMP-like protein
JGI ISS
PTHR21136 Panther
SNARE PROTEINS
JGI ISS
PTHR21136:SF46 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00957 PFAM
Synaptobrevin
JGI ISS
UniRef100_I1KN03 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KN03_SOYBN
SoyBase E_val: 3.00E-163 ISS
UniRef100_O23429 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein 724 n=1 Tax=Arabidopsis thaliana RepID=VA724_ARATH
SoyBase E_val: 1.00E-137 ISS
Expression Patterns of Glyma07g37760
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma07g37760
Paralog Evidence Comments
Glyma17g02870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g37760 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g248300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g37760
Coding sequences of Glyma07g37760
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g37760.1 sequence type=CDS gene model=Glyma07g37760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTCAGGAATCGTTTATATATAGCTTCGTGGCTCGGGGGACGATGGTGTTAGCCGAGTACACCGAGTTCACTGGGAACTTCCCTGCAATTGCAGCTCAGTGCCTCCAGAAACTACCCTCTTCCAATAACAAGTTCACCTACAATTGCGACCACCACACCTTCAATTTTCTCGTCGAAGACGGTTACGCTTACTGTGTTGTTGCCAAGGAATCTGTTAGCAAACAAATCTCTATTGCTTTCCTTGAACGTGTAAAAGCGGACTTTAAGAAAAGATATGGTGGTGGAAAGGCAGACACGGCTGTTGCCAAAAGTCTCAACAAGGAGTTTGGACCAGTTATGAAAGAGCACATGAAGTATATCATAGACCATGCTGAAGAGATTGAAAAGCTAATAAAAGTGAAGGCTCAAGTTTCAGAAGTTAAAAGTATTATGTTAGAGAACATTGATAAGGCCATTGATAGAGGAGAAAATCTAACTATTCTGGCGGACAAGACAGAGACTTTGCACTCACAAGCCCAGGAATTCAAAAAGCAAGGAACTCATGTCCGTCGGAAGATGTGGTATCAGAACATGAAAATCAAATTGGTTGTTCTTGGAATTTTGTTGCTTTTGGTCCTGGTTATCTGGCTTTCTGTTTGCCATGGATTCAACTGCGCAAACTAG
Predicted protein sequences of Glyma07g37760
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g37760.1 sequence type=predicted peptide gene model=Glyma07g37760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSQESFIYSFVARGTMVLAEYTEFTGNFPAIAAQCLQKLPSSNNKFTYNCDHHTFNFLVEDGYAYCVVAKESVSKQISIAFLERVKADFKKRYGGGKADTAVAKSLNKEFGPVMKEHMKYIIDHAEEIEKLIKVKAQVSEVKSIMLENIDKAIDRGENLTILADKTETLHSQAQEFKKQGTHVRRKMWYQNMKIKLVVLGILLLLVLVIWLSVCHGFNCAN*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
