SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g37751

Feature Type:gene_model
Chromosome:Gm07
Start:42712062
stop:42713692
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g37751
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G22580AT Annotation by Michelle Graham. TAIR10: Exostosin family protein | chr4:11889382-11890689 REVERSE LENGTH=435 SoyBaseE_val: 2.00E-60ISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
PTHR11062Panther EXOSTOSIN (HEPARAN SULFATE GLYCOSYLTRANSFERASE)-RELATED JGI ISS
PTHR11062:SF12Panther JGI ISS
PF03016PFAM Exostosin family JGI ISS
UniRef100_G7JLG7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan galactosyltransferase KATAMARI1-like protein n=1 Tax=Medicago truncatula RepID=G7JLG7_MEDTR SoyBaseE_val: 5.00E-66ISS
UniRef100_I1KN02UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KN02_SOYBN SoyBaseE_val: 2.00E-87ISS

Expression Patterns of Glyma07g37751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g37751 not represented in the dataset
Glyma07g37751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g37751
ParalogEvidenceComments
Glyma17g02880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g37751 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g248200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g37751
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g37751
>Glyma07g37751.1   sequence type=CDS   gene model=Glyma07g37751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGGCCAATGCTTTCGGCTAGTTTCTGCTTGCAGCCTCCCGGGGACACGACCACGCGCCGGTCCACGTTCGACGCGGTACTCGCGGGGTGCATACCGGTTTTCTTCGAGGAGCTTTCGGCGAAGGCTCAGTATGGGTGGCATTTGCCGGAGGCGGAGTTTGAGGAGCTGTCTGTGTTTATACCGAAGGAGGAGGTGGTGTTCAGAGGGATGAGGATTTTGGATGTGTTGCAACAGATACCGAGAGGTAGGGTTAGGAGAATGAGGGAGAGGGTTTTGGAGTTGATGCCGAGTGTCTTTTACAGGAAGCATAATAGTTCCCCGGGTCTCAAAACTAAGAAGGATGCGGTTGATTTGGCCATTGATGGTACATTGGATAAGATTTGA
Predicted protein sequences of Glyma07g37751
>Glyma07g37751.1   sequence type=predicted peptide   gene model=Glyma07g37751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRPMLSASFCLQPPGDTTTRRSTFDAVLAGCIPVFFEELSAKAQYGWHLPEAEFEELSVFIPKEEVVFRGMRILDVLQQIPRGRVRRMRERVLELMPSVFYRKHNSSPGLKTKKDAVDLAIDGTLDKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo