Glyma07g37010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g37010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g37010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g37010

Feature Type:	gene_model
Chromosome:	Gm07
Start:	42190426
stop:	42193373
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g37010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16980	AT	Annotation by Michelle Graham. TAIR10: RNA polymerases M/15 Kd subunit \| chr3:5794526-5795699 FORWARD LENGTH=114	SoyBase	E_val: 9.00E-61	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0000419	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase V complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005665	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase II, core complex	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
KOG2691	KOG	RNA polymerase II subunit 9	JGI		ISS
PTHR11239	Panther	DNA-DIRECTED RNA POLYMERASE	JGI		ISS
PF01096	PFAM	Transcription factor S-II (TFIIS)	JGI		ISS
PF02150	PFAM	RNA polymerases M/15 Kd subunit	JGI		ISS
UniRef100_I1KMS4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase subunit n=1 Tax=Glycine max RepID=I1KMS4_SOYBN	SoyBase	E_val: 1.00E-79	ISS
UniRef100_I1KMS4	UniRef	Annotation by Michelle Graham. Best UniRef hit: DNA-directed RNA polymerase subunit n=1 Tax=Glycine max RepID=I1KMS4_SOYBN	SoyBase	E_val: 1.00E-79	ISS

Expression Patterns of Glyma07g37010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g37010 not represented in the dataset	Glyma07g37010 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g37010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g241200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g37010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g37010

Limit To All Plant Sequences

>Glyma07g37010.1   sequence type=CDS   gene model=Glyma07g37010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGCATGAAATTTTGCCGCCGCTGCAACAACGTTCTGTACCCTACGGAGGATAAGGAGGAGAAGCTACTTCTCTATGCTTGCCGCAACTGCAATCACGAGGAGATTGCCGATAGTAACGTTGTGTATAGAAATAAGATACATCATTCTGTTCAACGGCGCACTCGAGAGCTGGAAAATGTAGCTGCAGATCCAACACTTCCTCGCACCAAGTCTGTTCGCTGCTCTCAATGCAATCATGGAGAAGCTGTCTTTTTCAAGGCACCAGTAAAAGGGGAAGAAGGCATGGCCCTCATTTTTGTTTGCTGCAACCCAACTTGTGGCTACCGTTGGAGAGACTAG

Predicted protein sequences of Glyma07g37010

Limit To All Plant Sequences

>Glyma07g37010.1   sequence type=predicted peptide   gene model=Glyma07g37010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSMKFCRRCNNVLYPTEDKEEKLLLYACRNCNHEEIADSNVVYRNKIHHSVQRRTRELENVAADPTLPRTKSVRCSQCNHGEAVFFKAPVKGEEGMALIFVCCNPTCGYRWRD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain