SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g36700

Feature Type:gene_model
Chromosome:Gm07
Start:42036225
stop:42037285
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g36700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49480AT Annotation by Michelle Graham. TAIR10: Ca2+-binding protein 1 | chr5:20070812-20071294 FORWARD LENGTH=160 SoyBaseE_val: 9.00E-51ISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
KOG0027 KOG Calmodulin and related proteins (EF-Hand superfamily) JGI ISS
PTHR10891Panther CALMODULIN JGI ISS
UniRef100_I1KMQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMQ0_SOYBN SoyBaseE_val: 4.00E-102ISS
UniRef100_Q9SWP6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hypersensitive reaction associated Ca2+-binding protein n=1 Tax=Phaseolus vulgaris RepID=Q9SWP6_PHAVU SoyBaseE_val: 2.00E-69ISS

Expression Patterns of Glyma07g36700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g36700
ParalogEvidenceComments
Glyma17g03910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g36700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g238700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g36700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g36700
>Glyma07g36700.1   sequence type=CDS   gene model=Glyma07g36700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGCCCTTCCGCCTCCCATTTCCGACCGGCATTCCACGTCCTCGACGCCGACCACGACGGCAAAATCAGCCACGACGACCTCCGCGCCTTCTACGCCGGAGTCGGCGGAGAAGGAGACGACGTGATCGGGGCAATGATGACGCTGGCCGACACCAACAAGGACGGGTTCGTGGAGTACGAGGAGTTCGAGCGCGTGGTCGCGGCGGAGAGAAAACCCGTGGGGTGTGGGGCCATGGAGGACGTGTTCAGGGTCATGGACAAGGACGGCGACGGCAAGCTCAGCCACCGCGACCTGAAGACTTACATGGCCTGGGCTGGCTTTTCGGCCACCGACGACGACATCAACGCCATGATCCGGTTCGGCGGCGGCGACCAAAACGGCGGCGTTACGTTCGATGGTTTGCTTCGTATATTGGCGCTTGAATGTTCCGCCGCTAATTAA
Predicted protein sequences of Glyma07g36700
>Glyma07g36700.1   sequence type=predicted peptide   gene model=Glyma07g36700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCPSASHFRPAFHVLDADHDGKISHDDLRAFYAGVGGEGDDVIGAMMTLADTNKDGFVEYEEFERVVAAERKPVGCGAMEDVFRVMDKDGDGKLSHRDLKTYMAWAGFSATDDDINAMIRFGGGDQNGGVTFDGLLRILALECSAAN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo