SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g36520

Feature Type:gene_model
Chromosome:Gm07
Start:41884022
stop:41884516
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g36520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49600AT Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 | chr5:20130780-20131295 FORWARD LENGTH=171 SoyBaseE_val: 9.00E-47ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04398PFAM Protein of unknown function, DUF538 JGI ISS
UniRef100_C6TA55UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TA55_SOYBN SoyBaseE_val: 2.00E-89ISS
UniRef100_Q9FGY5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Similarity to unknown protein n=1 Tax=Arabidopsis thaliana RepID=Q9FGY5_ARATH SoyBaseE_val: 4.00E-44ISS

Expression Patterns of Glyma07g36520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g36520
ParalogEvidenceComments
Glyma17g04100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g36520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g236700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g36520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g36520
>Glyma07g36520.2   sequence type=CDS   gene model=Glyma07g36520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACAAATTAGCACAACCAATGTATTCCTTAACAGAGGAATTGAAGTCCAAAGCTGAGGTGTATTATGGGGACAAAGTTTGCAGGGAGAAGTTCTCTTTGTTGCTGGCAGAAATAGGTCTACCTGATGGATTATTAACCATTCAAGACATTGAGGAATGTGGTTATGTCAAGGAAATAGGCTTTGTTTGGCTGAAGCTCAAGAAGAAGAGGGAGCACAGGATTGATAACATTCTTGTTTGCTATGATACAGTGGTAACTGCTTATGTGGAGCAAAACAAGATCAAGAATCTCACTGGGGTGAAGGCCAGGGACTTCTTGCTTTGGTTCACTTTGAACGAGATTTGTGTTAAGGGCAATCCAGAAGAACCTGTCATCACTTTCAAGTCTTTGGTTGGTTTGTCTATGTCTTTTCCATTGTCATTGTTTGAAGCAGGGAAAGAAGCCAAGGAAGAAGCAAAGGAAGAGAAGTGGTGGAGGATGATCAAACTGTAA
Predicted protein sequences of Glyma07g36520
>Glyma07g36520.2   sequence type=predicted peptide   gene model=Glyma07g36520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHKLAQPMYSLTEELKSKAEVYYGDKVCREKFSLLLAEIGLPDGLLTIQDIEECGYVKEIGFVWLKLKKKREHRIDNILVCYDTVVTAYVEQNKIKNLTGVKARDFLLWFTLNEICVKGNPEEPVITFKSLVGLSMSFPLSLFEAGKEAKEEAKEEKWWRMIKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo