Glyma07g36491 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g36491): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g36491): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g36491

Feature Type:	gene_model
Chromosome:	Gm07
Start:	41872264
stop:	41872592
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g36491

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G09610	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF579) \| chr1:3111789-3112637 FORWARD LENGTH=282	SoyBase	E_val: 3.00E-27	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0045491	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0030775	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glucuronoxylan 4-O-methyltransferase activity	SoyBase	N/A	ISS
PF04669	PFAM	Protein of unknown function (DUF579)	JGI		ISS
UniRef100_B3VV20	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein (Fragment) n=1 Tax=Populus tremula RepID=B3VV20_POPTN	SoyBase	E_val: 3.00E-26	ISS
UniRef100_C6TKB9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TKB9_SOYBN	SoyBase	E_val: 2.00E-30	ISS

Expression Patterns of Glyma07g36491

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g36491 not represented in the dataset	Glyma07g36491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g36491 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g236500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g36491

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g36491

Limit To All Plant Sequences

>Glyma07g36491.1   sequence type=CDS   gene model=Glyma07g36491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAAAAGAGGCAAAGGCTAAACTGGAAACTGAAGTTGGTCCAGTGACAGCAAGAGTTCTGGAGAAGAAGTCGCCGCGCAATTTCTTGGTGTTCGGGTTGGGGCACGACGGCCTGGTGTGGAACGCGCTGAATCACGGGGGAAGGACGATATTCCTGGAAGAAGACGAGTCATGGATTCAGCAAATGAGGAGAAGATTTCCAATGCTGGAGTGA

Predicted protein sequences of Glyma07g36491

Limit To All Plant Sequences

>Glyma07g36491.1   sequence type=predicted peptide   gene model=Glyma07g36491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKEAKAKLETEVGPVTARVLEKKSPRNFLVFGLGHDGLVWNALNHGGRTIFLEEDESWIQQMRRRFPMLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain