|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G09610 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF579) | chr1:3111789-3112637 FORWARD LENGTH=282 | SoyBase | E_val: 1.00E-25 | ISS |
| GO:0010413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process | SoyBase | N/A | ISS |
| GO:0045491 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan metabolic process | SoyBase | N/A | ISS |
| GO:0045492 | GO-bp | Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0030775 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glucuronoxylan 4-O-methyltransferase activity | SoyBase | N/A | ISS |
| PF04669 | PFAM | Protein of unknown function (DUF579) | JGI | ISS | |
| UniRef100_B3VV42 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein (Fragment) n=1 Tax=Populus tremula RepID=B3VV42_POPTN | SoyBase | E_val: 1.00E-25 | ISS |
| UniRef100_C6TKB9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TKB9_SOYBN | SoyBase | E_val: 7.00E-29 | ISS |
|
Glyma07g36480 not represented in the dataset |
Glyma07g36480 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g236400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g36480.1 sequence type=CDS gene model=Glyma07g36480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATCCTCAGGGTGATCTCCAACTTCTTAAGCCAATGTCATCGTGTTTCCTTGAAGGAGTTTAATACTGGCAGATGTTGGAAGAAGCAGCTAAATATAGCAAAAGATGCCCGGCGTGTAGATGTACTATGTTACAGGATATATTTGAGCTACAGGCTTGTGGATGTGACAGCAAGAGTTCTGGAGAAGAAGTCGCCGTGCAATTTCTTGGTGTTCGGGTTGGGGCACGACGGCCTGATGTGGAACGCGCTGAATCACGGGGGAAGGACGATATTCCTGGAAGAAGAAGAGTCATGGATTCAGCAAATGAGAAGATTTCCAATGATGGAGTGA
>Glyma07g36480.1 sequence type=predicted peptide gene model=Glyma07g36480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MILRVISNFLSQCHRVSLKEFNTGRCWKKQLNIAKDARRVDVLCYRIYLSYRLVDVTARVLEKKSPCNFLVFGLGHDGLMWNALNHGGRTIFLEEEESWIQQMRRFPMME*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||