Glyma07g36430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g36430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g36430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g36430

Feature Type:	gene_model
Chromosome:	Gm07
Start:	41820901
stop:	41823758
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g36430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G06490	AT	Annotation by Michelle Graham. TAIR10: myb domain protein 108 \| chr3:2004298-2006358 FORWARD LENGTH=323	SoyBase	E_val: 2.00E-87	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009738	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0052542	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG0048	KOG	Transcription factor, Myb superfamily	JGI		ISS
PTHR10641	Panther	MYB-RELATED	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_C6T8B5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T8B5_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_G7IL36	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Myb-like transcription factor n=1 Tax=Medicago truncatula RepID=G7IL36_MEDTR	SoyBase	E_val: 2.00E-125	ISS

Expression Patterns of Glyma07g36430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g36430 not represented in the dataset	Glyma07g36430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g36430

Paralog	Evidence	Comments
Glyma17g04171	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g36430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g235900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g36430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g36430

Limit To All Plant Sequences

>Glyma07g36430.2   sequence type=CDS   gene model=Glyma07g36430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAGTTTATCGAGCCCCTCCCTTCTTTATCTCCCTTGTAACAATCCAACACTCTTTTCTTTCTCTCTCTTTCATACCTCTCCAACCAAGACCAATTTGAAAACCTCTTCAATCCAACAAACAAACGTTCTCCCTTTTGTTCTGAGAGAATCAATGGATGGAAAAGGAGCAAGAAGTAGCAACACCCTTTTAAGTAGTGAGGACGAGATGGACCTTCGAAGAGGCCCTTGGACCGTCGATGAAGACCTCACTCTTATCAATTACGTTGCCACTCATGGCGAAGGTCGCTGGAATACCCTCGCCCTCTCTGCTGGGCTGAAACGAACGGGGAAGAGTTGCAGATTGAGGTGGCTGAATTATCTGCGTCCTGATGTTCGACGTGGAAACATCACGCTTGAAGAACAACTTTTGATTCTGGAGCTCCATTCTCGCTGGGGAAACCGATGGTCGAAAATTGCTCAATATTTGCCTGGTAGAACCGACAATGAGATAAAGAACTATTGGAGAACCCGTGTCCAAAAGCATGCCAAGCAACTCAAATGCGACGTGAATAGCAAGCAATTCAAGGACACCATGCGTTACATTTGGATGCCAAGGCTCGTGGAACGCATTCAAGCCACCGCTGCCGCCTCCGCCACCACAACCGTTACCGCTACCACCGCGACCAACAATGCATACACCTACGGAAGCAACCTTAATAACAACAAATTCGAGGTTCACGATCACAAGGGCAAAATGGGGTTAACCGATCCTTCAGTTATGAACAATGACTTAGTGGGTTCACATGTCACGCAAAGTTACACCCCTGAGAATAGTAGCACCGGTGCGTCATCATCAGACTCGTTTGGGACTCAAGTCTCAGCAATTTCTGATTTGACTGAATATTACACTGTCACTGTTAGTGGTAACAATAACAATACTAATTCTGCGGATTATTATCAACCCTCTCAAATTAGTTACTCGGATAGTTGCATCACAAGCCCATCTGGGTTGTTCCCTCAAGGGCTAGATTTTCAATCCATGGATCCAAACACCCCGTGGAACATGCAAAGTGGGGACTCCTCTGACAGTTTTTGGAACGTTGAAAGCATGTTGTTCTTAGAGCAGCAACTCATGAATGACAACATGTGA

Predicted protein sequences of Glyma07g36430

Limit To All Plant Sequences

>Glyma07g36430.2   sequence type=predicted peptide   gene model=Glyma07g36430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMSLSSPSLLYLPCNNPTLFSFSLFHTSPTKTNLKTSSIQQTNVLPFVLRESMDGKGARSSNTLLSSEDEMDLRRGPWTVDEDLTLINYVATHGEGRWNTLALSAGLKRTGKSCRLRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYIWMPRLVERIQATAAASATTTVTATTATNNAYTYGSNLNNNKFEVHDHKGKMGLTDPSVMNNDLVGSHVTQSYTPENSSTGASSSDSFGTQVSAISDLTEYYTVTVSGNNNNTNSADYYQPSQISYSDSCITSPSGLFPQGLDFQSMDPNTPWNMQSGDSSDSFWNVESMLFLEQQLMNDNM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain