SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g36380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g36380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g36380

Feature Type:gene_model
Chromosome:Gm07
Start:41779989
stop:41781270
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G30510AT Annotation by Michelle Graham. TAIR10: ribosomal protein S1 | chr5:11619262-11621223 REVERSE LENGTH=416 SoyBaseE_val: 2.00E-79ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR10724Panther TEX PROTEIN-RELATEDTRANSCRIPTION ACCESSORY PROTEIN (S1 RNA BINDING DOMAIN) JGI ISS
PF00575PFAM S1 RNA binding domain JGI ISS
UniRef100_I1KML9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KML9_SOYBN SoyBaseE_val: 4.00E-133ISS
UniRef100_P29344UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S1, chloroplastic n=1 Tax=Spinacia oleracea RepID=RR1_SPIOL SoyBaseE_val: 7.00E-82ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g36380 not represented in the dataset

Glyma07g36380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g04190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g36380.1   sequence type=CDS   gene model=Glyma07g36380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTCAGATTAAAGGCACTGTGTTCTACACAGATGCCAATGGAGCAGTTGTTGATATCACTGCCAAGTCTTCGGCATATTTGCCACTGCAAGAGGCGTGCATTCACAGAGTTAAGCATGAGTTTTTGATCGTTGGTGAGAACTCAGTGGATGATAGCTTGGTCTTGAGTTTAAGGGCTCTTCAGTTTGACCTTGCATGGGAACGATGTAGACAGCTTCAAGCAGAAGATGTTACTGTCAAGGGTAAGATTGTGGGGGTGAACAAAGGCGGAGTGGTGGCTGAGTTGGAAGGGCTTAGAGGATTTGTTCCATTGTCACAAATATCAACGAACTCAAATGTAGAAGAGCTTCTTGATAAGGAGCTTCCTCTTAAGTTTGTGGAGGTGGATGAGGAACAATCTAGACTTGTCCTGAGCAACCGCAAGGCCGTAGCTGGCAACCAGGCGCAGCTAGGAATTGGATCAGTGGTCACTGGCTCTGCGGAGGAGATGGCTCAGACATTCAGACAGAGAATAGCCCAAGCAGAAGCTATGGCTCGTGCAGACATGCTTAGGTTCCAGTCTGAG

>Glyma07g36380.1   sequence type=predicted peptide   gene model=Glyma07g36380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TQIKGTVFYTDANGAVVDITAKSSAYLPLQEACIHRVKHEFLIVGENSVDDSLVLSLRALQFDLAWERCRQLQAEDVTVKGKIVGVNKGGVVAELEGLRGFVPLSQISTNSNVEELLDKELPLKFVEVDEEQSRLVLSNRKAVAGNQAQLGIGSVVTGSAEEMAQTFRQRIAQAEAMARADMLRFQSE







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo