Glyma07g36300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g36300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g36300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g36300

Feature Type:	gene_model
Chromosome:	Gm07
Start:	41659291
stop:	41661540
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g36300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G43760	AT	Annotation by Michelle Graham. TAIR10: molybdopterin biosynthesis MoaE family protein \| chr2:18133276-18133872 FORWARD LENGTH=198	SoyBase	E_val: 7.00E-92	ISS
GO:0006777	GO-bp	Annotation by Michelle Graham. GO Biological Process: Mo-molybdopterin cofactor biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3307	KOG	Molybdopterin converting factor subunit 2	JGI		ISS
PTHR23404	Panther	MOLYBDOPTERIN SYNTHASE RELATED	JGI		ISS
PTHR23404:SF2	Panther	MOLYBDOPTERIN SYNTHASE LARGE SUBUNIT	JGI		ISS
PF02391	PFAM	MoaE protein	JGI		ISS
UniRef100_G7IZR4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Molybdopterin synthase catalytic subunit n=1 Tax=Medicago truncatula RepID=G7IZR4_MEDTR	SoyBase	E_val: 4.00E-109	ISS
UniRef100_I1KML2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KML2_SOYBN	SoyBase	E_val: 6.00E-136	ISS

Expression Patterns of Glyma07g36300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g36300 not represented in the dataset	Glyma07g36300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g36300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g235100	Wm82.a2.v1	IGC	As supplied by JGI
Glyma07g36311	Wm82.a1.v1.1	IGC	Correspondences based on a combination of genome sequence coordinate overlap (fjoin) and sequence similarity (ungapped blastn)

References for Glyma07g36300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g36300

Limit To All Plant Sequences

>Glyma07g36300.1   sequence type=CDS   gene model=Glyma07g36300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCTGAAGATGATAGGAATCTTGTCGAAATCATGGAAACCCTGAATCCAATAGATGTTGCTAAATACATGAATTTTGTTGGTGCCCCCCAAGCTGGTGCTATAGCTACATTTTCAGGCACAACTCGCGACACCTTTGAAGGAAAAACAGTCGTGGAGTTGAGATACGAAGCTTATGTTCCAATGGCAATACGCTGTATCAAGTCAATCTGTTCATCTGCTAGAGCATCCTGGAACATACATTCTGTTGCTGTTGCTCATCGTCTAGGCACAGTGCCTGTTGGTGAAACAAGTGTCTTCGTTGCTGTCTCGTCTGTCCACCGGGCTGATGCGCTGGAGGCTTGTAGATTTTTGATAGATGAGATAAAAGCACAAGTTCCTATTTGGAAAAAGGAGGTCTATTCAAATGGGGAGGTTTGGAAGGAGAACAGTGAGTTCCTAGAGAGGAGGTCTGAGCTTGGTAACAAGAATGCAGCTTGCTGTGGGAAAAAGGCAGAAATTAAAGAGCACAACAAAAAGTCTTGCTGTAGGACCAAGGTTCGGGCTGATGACGAATGTAGCTAG

Predicted protein sequences of Glyma07g36300

Limit To All Plant Sequences

>Glyma07g36300.1   sequence type=predicted peptide   gene model=Glyma07g36300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAEDDRNLVEIMETLNPIDVAKYMNFVGAPQAGAIATFSGTTRDTFEGKTVVELRYEAYVPMAIRCIKSICSSARASWNIHSVAVAHRLGTVPVGETSVFVAVSSVHRADALEACRFLIDEIKAQVPIWKKEVYSNGEVWKENSEFLERRSELGNKNAACCGKKAEIKEHNKKSCCRTKVRADDECS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain