SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g36040

Feature Type:gene_model
Chromosome:Gm07
Start:41422102
stop:41425193
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g36040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17240AT Annotation by Michelle Graham. TAIR10: lipoamide dehydrogenase 2 | chr3:5890278-5892166 REVERSE LENGTH=507 SoyBaseE_val: 0ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0034976GO-bp Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005747GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I SoyBaseN/AISS
GO:0005759GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004148GO-mf Annotation by Michelle Graham. GO Molecular Function: dihydrolipoyl dehydrogenase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016668GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
GO:0050897GO-mf Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding SoyBaseN/AISS
KOG1335 KOG Dihydrolipoamide dehydrogenase JGI ISS
PTHR22912Panther DISULFIDE OXIDOREDUCTASE JGI ISS
PTHR22912:SF20Panther DIHYDROLIPOAMIDE DEHYDROGENASE JGI ISS
PF00070PFAM Pyridine nucleotide-disulphide oxidoreductase JGI ISS
PF02852PFAM Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain JGI ISS
PF07992PFAM Pyridine nucleotide-disulphide oxidoreductase JGI ISS
UniRef100_O81413UniRef Annotation by Michelle Graham. Best UniRef hit: Dihydrolipoyl dehydrogenase n=1 Tax=Glycine max RepID=O81413_SOYBN SoyBaseE_val: 0ISS
UniRef100_O81413UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dihydrolipoyl dehydrogenase n=1 Tax=Glycine max RepID=O81413_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma07g36040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g36040
ParalogEvidenceComments
Glyma17g04210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g36040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g232900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g36040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g36040
>Glyma07g36040.1   sequence type=CDS   gene model=Glyma07g36040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGATGGCAAACTTGGCTCGACGGAAGGGTTACGCCGTCGTTTTGTCGTCGAGGTCGTCGCTTTGTCTGACAAGGTGGAGGGGGTTCGCGTCCGGATCTGACGAAAACGACGTCGTGGTCATCGGCGGCGGTCCCGGCGGCTACGTGGCGGCCATTAAAGCGGCGCAGCTGGGTCTGAAAACCACTTGCATCGAAAAACGTGGCACTCTCGGCGGTACCTGCCTCAACGTCGGATGCATCCCTTCCAAGGCACTTTTGCATTCTTCCCACATGTATCATGAGGCTAAACATGCATTTGCCAACCATGGGGTCAAGTTTTCATCTGTCGAGGTTGATTTGCCAGCCATGATGGCCCAAAAAGATAAAGCAGTTTCTAATCTTACCAAGGGTATTGAAGGTCTATTCAAGAAAAACAAGGTAAACTATGTCAAAGGTTATGGCAAATTAGTTTCACCATCTGAGGTCTCTGTGGACACCACTGAAGGTGGAAATACTGTTGTGAAAGGCAAGCATATTATAATTGCCACTGGCTCGGATGTGAAATCTCTGCCTGGGATCACTATTGATGAAAAGAAAGTTGTTTCATCAACGGGAGCTCTTGCTTTGACTGAAATCCCCAAGAGACTCATAGTCATTGGGGCAGGCTACATTGGGCTGGAAATGGGCTCAGTATGGGGCCGACTTGGCTCCGAGATAACAGTTGTTGAGTTTGCATCGGAGATTGTTCCAACCATGGATGCGGAGGTCCGGAAGCAGTTTCAGCGTTCTCTTGAGAAGCAAGGCATGAAATTCAAGCTGAAGACTAAGGTGGTTGGAGTTGATACTTCTGGGGATGGTGTGAAGCTAACTCTTGAACCAGCAGCTGGTGGTGATCAGACTACACTTGAAGCAGATGTTGTCCTGGTATCTGCTGGTAGGACCCCATTCACTGCCGAACTTGGGTTGGACAAGATAGGAGTTGAAACTGACAAGATTGGACGGATTTTGGTAAATGAAAGATTTGCCACAAATGTCTCTGGTGTTTATGCAATTGGAGATGTAATTCCAGGCCCAATGTTGGCACACAAGGCGGAAGAAGATGGTGTTGCTTGTGTTGAGTACATAGCTGGTAAGGTTGGTCATGTGGATTATGACAAAGTCCCTGGCGTTGTCTATACAATGCCCGAGGTTGCATCTGTTGGGAAGACAGAGGAGCAGGTGAAGGAACTTGGAGTTGAATACCGTGTTGGCAAGTTCCCATTCCTGGCTAATAGCAGAGCTAAGGCAATTGACAATGCTGAAGGACTGGTGAAGATATTGGCTGAAAAGGAGACAGACAAGATATTGGGAGTGCACATTATGGCGCCCAATGCAGGAGAGCTTATTCATGAAGCTGCAATAGCACTACAGTATGATGCATCAAGTGAGGACATTGCACGTGTGTGCCATGCACATCCAACAATGAGCGAGGCTGTGAAAGAAGCCGCAATGGCCACTTATGACAAGCCCATTCACATCTAA
Predicted protein sequences of Glyma07g36040
>Glyma07g36040.1   sequence type=predicted peptide   gene model=Glyma07g36040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMANLARRKGYAVVLSSRSSLCLTRWRGFASGSDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKHAFANHGVKFSSVEVDLPAMMAQKDKAVSNLTKGIEGLFKKNKVNYVKGYGKLVSPSEVSVDTTEGGNTVVKGKHIIIATGSDVKSLPGITIDEKKVVSSTGALALTEIPKRLIVIGAGYIGLEMGSVWGRLGSEITVVEFASEIVPTMDAEVRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTLEPAAGGDQTTLEADVVLVSAGRTPFTAELGLDKIGVETDKIGRILVNERFATNVSGVYAIGDVIPGPMLAHKAEEDGVACVEYIAGKVGHVDYDKVPGVVYTMPEVASVGKTEEQVKELGVEYRVGKFPFLANSRAKAIDNAEGLVKILAEKETDKILGVHIMAPNAGELIHEAAIALQYDASSEDIARVCHAHPTMSEAVKEAAMATYDKPIHI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo