SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g35891

Feature Type:gene_model
Chromosome:Gm07
Start:41282834
stop:41286209
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g35891
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13500AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G25265.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr5:4338676-4340827 FORW SoyBaseE_val: 2.00E-107ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
UniRef100_B9GG82UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GG82_POPTR SoyBaseE_val: 2.00E-115ISS
UniRef100_E9KID2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Root determined nodulation 1 n=2 Tax=Medicago truncatula RepID=E9KID2_MEDTR SoyBaseE_val: 1.00E-114ISS

Expression Patterns of Glyma07g35891
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g35891 not represented in the dataset
Glyma07g35891 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g35891
ParalogEvidenceComments
Glyma20g08020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g35891 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma07g35891
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g35891
>Glyma07g35891.1   sequence type=CDS   gene model=Glyma07g35891   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACAATACAGGAGTTGGTGGCAAGATGTCAGGTCTGCCAAAGAAACAAATATCAGGCCTCTTCTCCAGCAGGGCTACTGCAACCACTCCCTGTGCCTTATCAGGGTTATGTTGTCATGAATAGACCATGGGCTTTTGTCCAGTGGCTGGAGAAAGCAGACATTGAGGAAGAATATATTTTGATGGCAGAACCTGACCACATATTTGCGAACGGTCCTATTACTGATATTGATCCCATTGGCAATTCTCCTGTAATCATTCAGAAGTCCTTGCTGGAGGAAATAGCTCCCACATGGGTGAATATTTCCTTGCAAATGAAAGATGATCCAGAAACTGATGAAACTTTTGGATGGGTACTTGAAATGTATGCGTACGCTGTAGCATCAGCTTTGCACGGTGTACGGCATATTCTTCATGATAACTTCATGCTCCAGCCACCATGGGACTTTGATGTTGAGAACAAGTTTATAATCCATTATACTTATGCATGTGACTACAATTTAAAGGGGGAACTAACATATGGGAAGATTGGAGAATGGCGTTTTAACAAGAGATTTTATCTAACAGGTCCTCCACCCAAAAACCTTTCCTTACCCCCTCCTGGAGTTCCTGAAAGTGTGGTGCTGCTAGTAAAGATGATTAATGAGGCTACTGCTAACATACCTAAATGGGATTCCTTAAATAGAAGCTGA
Predicted protein sequences of Glyma07g35891
>Glyma07g35891.1   sequence type=predicted peptide   gene model=Glyma07g35891   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTIQELVARCQVCQRNKYQASSPAGLLQPLPVPYQGYVVMNRPWAFVQWLEKADIEEEYILMAEPDHIFANGPITDIDPIGNSPVIIQKSLLEEIAPTWVNISLQMKDDPETDETFGWVLEMYAYAVASALHGVRHILHDNFMLQPPWDFDVENKFIIHYTYACDYNLKGELTYGKIGEWRFNKRFYLTGPPPKNLSLPPPGVPESVVLLVKMINEATANIPKWDSLNRS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo