SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g35848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g35848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g35848

Feature Type:gene_model
Chromosome:Gm07
Start:41258258
stop:41259147
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21700AT Annotation by Michelle Graham. TAIR10: SWITCH/sucrose nonfermenting 3C | chr1:7620156-7623978 REVERSE LENGTH=807 SoyBaseE_val: 1.00E-36ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0040029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016514GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SWI/SNF complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12802Panther SWI/SNF COMPLEX-RELATED JGI ISS
PTHR12802:SF21Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7J4Z5UniRef Annotation by Michelle Graham. Most informative UniRef hit: SWI/SNF complex subunit SMARCC2 n=1 Tax=Medicago truncatula RepID=G7J4Z5_MEDTR SoyBaseE_val: 1.00E-72ISS
UniRef100_UPI000233A500UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A500 related cluster n=1 Tax=unknown RepID=UPI000233A500 SoyBaseE_val: 5.00E-112ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g35848 not represented in the dataset

Glyma07g35848 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g231300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g35848.1   sequence type=CDS   gene model=Glyma07g35848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGCCTCTCCTTCAGATAATCGAACTAGATGGAGGAAGCGCAAGAGAGATTCGCAAATCAGTCGGCGCCACCAGAAGCACAAGGAGGAGGAGGACGACGACGACGACGAAAACCCCAATGCGGAGGAAGACCTCACCAAACACAACTACGATTTGGAAGACCAAATGCACCACAACCACCCTAATTCGCAACCTCACGTGGAGACGGAGGTCCTCTCCGACCACGGCGTTCAGATTTTTCAGTTCCCGACGGTGATGAAGCGCTCTGTGAACTTCCCTCACTCCTCCATCACCGCAATTGTTGCTCTGGAGCGTGCCCTCGAGTCCGGAGAGAACAAGGCTCCAAGCGCTCTCGCTGCTCCGGTTCTCGAGAATGTGTCTCATGGCCAACTTCAAGCACTGTCGTTTGTTCCCTCCGATAGCTTTGCTTTCGACGGTGATTCCTCTTTTGTCATCACTCCCCCTCCCATTTTGGAAGGTCGTGGCATTGTTAAGCGCTATGGAACTAAGGCTCTTGTAGTTCCAATGCATTCAAATTGGTTTTTGCCTGCCACGGTGCACAGGTTGGAGAGGCAAGTGGTGCTGCATTTCAAACCTACTTAA

>Glyma07g35848.1   sequence type=predicted peptide   gene model=Glyma07g35848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPASPSDNRTRWRKRKRDSQISRRHQKHKEEEDDDDDENPNAEEDLTKHNYDLEDQMHHNHPNSQPHVETEVLSDHGVQIFQFPTVMKRSVNFPHSSITAIVALERALESGENKAPSALAAPVLENVSHGQLQALSFVPSDSFAFDGDSSFVITPPPILEGRGIVKRYGTKALVVPMHSNWFLPATVHRLERQVVLHFKPT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo