Glyma07g35848 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g35848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g35848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g35848

Feature Type:	gene_model
Chromosome:	Gm07
Start:	41258258
stop:	41259147
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g35848

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G21700	AT	Annotation by Michelle Graham. TAIR10: SWITCH/sucrose nonfermenting 3C \| chr1:7620156-7623978 REVERSE LENGTH=807	SoyBase	E_val: 1.00E-36	ISS
GO:0006338	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin remodeling	SoyBase	N/A	ISS
GO:0007062	GO-bp	Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion	SoyBase	N/A	ISS
GO:0031048	GO-bp	Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA	SoyBase	N/A	ISS
GO:0040029	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic	SoyBase	N/A	ISS
GO:0045132	GO-bp	Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016514	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: SWI/SNF complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR12802	Panther	SWI/SNF COMPLEX-RELATED	JGI		ISS
PTHR12802:SF21	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7J4Z5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SWI/SNF complex subunit SMARCC2 n=1 Tax=Medicago truncatula RepID=G7J4Z5_MEDTR	SoyBase	E_val: 1.00E-72	ISS
UniRef100_UPI000233A500	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A500 related cluster n=1 Tax=unknown RepID=UPI000233A500	SoyBase	E_val: 5.00E-112	ISS

Expression Patterns of Glyma07g35848

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g35848 not represented in the dataset	Glyma07g35848 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g35848 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g231300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g35848

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g35848

Limit To All Plant Sequences

>Glyma07g35848.1   sequence type=CDS   gene model=Glyma07g35848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGCCTCTCCTTCAGATAATCGAACTAGATGGAGGAAGCGCAAGAGAGATTCGCAAATCAGTCGGCGCCACCAGAAGCACAAGGAGGAGGAGGACGACGACGACGACGAAAACCCCAATGCGGAGGAAGACCTCACCAAACACAACTACGATTTGGAAGACCAAATGCACCACAACCACCCTAATTCGCAACCTCACGTGGAGACGGAGGTCCTCTCCGACCACGGCGTTCAGATTTTTCAGTTCCCGACGGTGATGAAGCGCTCTGTGAACTTCCCTCACTCCTCCATCACCGCAATTGTTGCTCTGGAGCGTGCCCTCGAGTCCGGAGAGAACAAGGCTCCAAGCGCTCTCGCTGCTCCGGTTCTCGAGAATGTGTCTCATGGCCAACTTCAAGCACTGTCGTTTGTTCCCTCCGATAGCTTTGCTTTCGACGGTGATTCCTCTTTTGTCATCACTCCCCCTCCCATTTTGGAAGGTCGTGGCATTGTTAAGCGCTATGGAACTAAGGCTCTTGTAGTTCCAATGCATTCAAATTGGTTTTTGCCTGCCACGGTGCACAGGTTGGAGAGGCAAGTGGTGCTGCATTTCAAACCTACTTAA

Predicted protein sequences of Glyma07g35848

Limit To All Plant Sequences

>Glyma07g35848.1   sequence type=predicted peptide   gene model=Glyma07g35848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPASPSDNRTRWRKRKRDSQISRRHQKHKEEEDDDDDENPNAEEDLTKHNYDLEDQMHHNHPNSQPHVETEVLSDHGVQIFQFPTVMKRSVNFPHSSITAIVALERALESGENKAPSALAAPVLENVSHGQLQALSFVPSDSFAFDGDSSFVITPPPILEGRGIVKRYGTKALVVPMHSNWFLPATVHRLERQVVLHFKPT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain