Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g35460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g35460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma07g35460
Feature Type: gene_model
Chromosome: Gm07
Start: 40636364
stop: 40643755
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g35460
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G14000 AT
Annotation by Michelle Graham. TAIR10: VH1-interacting kinase | chr1:4797606-4800043 FORWARD LENGTH=438
SoyBase E_val: 0 ISS
GO:0000165 GO-bp
Annotation by Michelle Graham. GO Biological Process: MAPK cascade
SoyBase N/A ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0006612 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane
SoyBase N/A ISS
GO:0007154 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell communication
SoyBase N/A ISS
GO:0007165 GO-bp
Annotation by Michelle Graham. GO Biological Process: signal transduction
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0009414 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to water deprivation
SoyBase N/A ISS
GO:0009723 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus
SoyBase N/A ISS
GO:0009733 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus
SoyBase N/A ISS
GO:0009734 GO-bp
Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway
SoyBase N/A ISS
GO:0009738 GO-bp
Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009742 GO-bp
Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway
SoyBase N/A ISS
GO:0009753 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus
SoyBase N/A ISS
GO:0009862 GO-bp
Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009863 GO-bp
Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009867 GO-bp
Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway
SoyBase N/A ISS
GO:0009966 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of signal transduction
SoyBase N/A ISS
GO:0010305 GO-bp
Annotation by Michelle Graham. GO Biological Process: leaf vascular tissue pattern formation
SoyBase N/A ISS
GO:0010363 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response
SoyBase N/A ISS
GO:0030968 GO-bp
Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response
SoyBase N/A ISS
GO:0031348 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response
SoyBase N/A ISS
GO:0035556 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction
SoyBase N/A ISS
GO:0042538 GO-bp
Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response
SoyBase N/A ISS
GO:0043069 GO-bp
Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death
SoyBase N/A ISS
GO:0050832 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to fungus
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0004712 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine/tyrosine kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
KOG0192
KOG
Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs
JGI ISS
PTHR23257 Panther
SERINE-THREONINE PROTEIN KINASE
JGI ISS
PTHR23257:SF89 Panther
ANKYRIN-KINASE
JGI ISS
PF00023 PFAM
Ankyrin repeat
JGI ISS
PF00069 PFAM
Protein kinase domain
JGI ISS
UniRef100_B9S913 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase, putative n=1 Tax=Ricinus communis RepID=B9S913_RICCO
SoyBase E_val: 0 ISS
UniRef100_I1KMF4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMF4_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma07g35460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma07g35460
Paralog Evidence Comments
Glyma20g03920 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma07g35460 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g228000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g35460
Coding sequences of Glyma07g35460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g35460.1 sequence type=CDS gene model=Glyma07g35460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTTCGGGTAGCAGCCACAGCAGTGAGAAGGAGAAGGAGAAACAGAGGGTGAGTCGCACGTCGCTGATACTGTGGCACGCGCACCAAAACGACGCCGGATCGGTGCGCAAGCTCCTCCAGGAGGATCCCTCGCTCGTCAAGGCCAGGGACTACGACAACCGAACGCCGCTCCATGTGGCGTCCCTCCACGGCTGGATCGACGTCGCCACGTGCCTCATCGAGTTCGGCGCCGACGTCAACGCGCAAGATCGCTGGAAAAACACCCCTCTGGCGGATGCGGAAGGAGCTAAGAAGAGTAATGTGATCGAGCTCTTGCAATCGCATGGAGGATTGTCTTTTGGGCAAAATGGAAGCCATTTCGAGCCGAAGCCGGTAGCGCCGCCGTTGCCGAACAAGTGTGATTGGGAAGTCGAGCCTACCGAGCTCGACTTCTCCAACTCGGTGCGAATCGGAAAGGGTTCTTTTGGTGAGATTTTAAAAGCCCATTGGCGTGGAACACCAGTTGCTGTTAAACGTATTCTTCCATCTCTTTCAGAAGATAGATTGGTGATTCAGGACTTCAGGCATGAGGTCAATTTGTTAGTGAAGCTTCGACACCCCAATATAGTTCAGTTTCTTGGAGCTGTTACTGCCAGGAAGCCCCTTATGCTAATTACTGAGTATCTAAGAGGGGGTGATCTTCATCAGTACCTCAAAGAAAAAGGTGCACTTAGTCCTGCAACAGCTATCAACTTTTCCATGGATATTGTCAGAGGAATGGCCTATCTTCACAATGAACCAAATGTTATAATTCATCGAGACCTAAAGCCAAGGAATGTTCTTTTAGTCAATTCTAGTGCCGACCATTTAAAAGTTGGAGATTTTGGATTGAGTAAGCTTATCACGGTCCAGAGTTCTCATGATGTATACAAAATGACTGGTGAAACTGGGAGCTACCGCTACATGGCTCCTGAAGTTTTCAAACATCGGAGATATGATAAGAAGGTTGATGTGTACTCCTTTGCAATGATTTTGTACGAGATGCTTGAAGGTGAACCACCTTTTGCAAGTCGTGAACCTTATGAAGGAGCAAAATACGCTGCTGAGGGACACAGGCCTCATTTTCGGGCAAAGGGTTATACTCCTGAATTGCAAGAGTTAACGGAGCAGTGTTGGGCTCATGACATGAGTCAGAGACCATCCTTCATAGAGATCCTAAAACGGCTTGAAAAGATCAAGGAGAATTTACCTACAGAGAATCACTGGCACTTGTTTACCTCATAA
Predicted protein sequences of Glyma07g35460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g35460.1 sequence type=predicted peptide gene model=Glyma07g35460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSGSSHSSEKEKEKQRVSRTSLILWHAHQNDAGSVRKLLQEDPSLVKARDYDNRTPLHVASLHGWIDVATCLIEFGADVNAQDRWKNTPLADAEGAKKSNVIELLQSHGGLSFGQNGSHFEPKPVAPPLPNKCDWEVEPTELDFSNSVRIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTARKPLMLITEYLRGGDLHQYLKEKGALSPATAINFSMDIVRGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLITVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVYSFAMILYEMLEGEPPFASREPYEGAKYAAEGHRPHFRAKGYTPELQELTEQCWAHDMSQRPSFIEILKRLEKIKENLPTENHWHLFTS*