SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g35000

Feature Type:gene_model
Chromosome:Gm07
Start:40121114
stop:40126427
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g35000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G31320AT Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 4 | chr1:11213107-11214032 FORWARD LENGTH=172 SoyBaseE_val: 9.00E-73ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009944GO-bp Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis SoyBaseN/AISS
GO:0010014GO-bp Annotation by Michelle Graham. GO Biological Process: meristem initiation SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF03195PFAM Protein of unknown function DUF260 JGI ISS
UniRef100_G7JIR8UniRef Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7JIR8_MEDTR SoyBaseE_val: 2.00E-96ISS
UniRef100_I1KMA9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMA9_SOYBN SoyBaseE_val: 2.00E-114ISS

Expression Patterns of Glyma07g35000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g35000
ParalogEvidenceComments
Glyma20g02850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g35000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g223600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g35000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g35000
>Glyma07g35000.1   sequence type=CDS   gene model=Glyma07g35000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGATGGTGGTAGAAAGCAGGGTGCACCCTCACCCTGTGCTGCATGCAAGCTCCTTAGGAGAAGGTGTGCTCAGGACTGTGTTTTTGCTCCTTATTTTCCTGCTGATGAGCCTCAGAAGTTTGCAAATGTGCACAAAGTCTTTGGTGCCAGCAATGTCAACAAGATGCTTCAGGACTTAGCAGAGCATCAGCGAGGAGATGCAGTGAGCAGCATGGTGTATGAAGCAAATGCAAGAGTGAGGGACCCTGTGTATGGCTGCGTAGGGGCCATCTCATCTCTTCAGCAACAGATTGATGTGTTGCAGACCCAATTGGCCGTGGCACAGGCTGAAGCTGTGCACCTCAGGGTGCGCCAAACTGCATCACTCTACAGCCCCACTAGCCCAACCAACAGTGGCTCTCCATCACAAGCCAAGCCTATTTTTGACATGGACATGGTGGTGGACCAGAACAGCTATGGTGATTCAATGTGGTGA
Predicted protein sequences of Glyma07g35000
>Glyma07g35000.1   sequence type=predicted peptide   gene model=Glyma07g35000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDGGRKQGAPSPCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQDLAEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLAVAQAEAVHLRVRQTASLYSPTSPTNSGSPSQAKPIFDMDMVVDQNSYGDSMW*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo