SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g34900

Feature Type:gene_model
Chromosome:Gm07
Start:39948598
stop:39953475
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g34900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04760AT Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 726 | chr1:1334760-1336070 FORWARD LENGTH=220 SoyBaseE_val: 8.00E-124ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0048451GO-bp Annotation by Michelle Graham. GO Biological Process: petal formation SoyBaseN/AISS
GO:0048453GO-bp Annotation by Michelle Graham. GO Biological Process: sepal formation SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG0859 KOG Synaptobrevin/VAMP-like protein JGI ISS
PTHR21136Panther SNARE PROTEINS JGI ISS
PTHR21136:SF46Panther SUBFAMILY NOT NAMED JGI ISS
PF00957PFAM Synaptobrevin JGI ISS
UniRef100_B7FGH4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein n=2 Tax=Medicago truncatula RepID=B7FGH4_MEDTR SoyBaseE_val: 6.00E-134ISS
UniRef100_I1KMA2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KMA2_SOYBN SoyBaseE_val: 3.00E-166ISS

Expression Patterns of Glyma07g34900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g34900
ParalogEvidenceComments
Glyma20g02720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g34900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g223000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g34900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g34900
>Glyma07g34900.1   sequence type=CDS   gene model=Glyma07g34900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCAGGACCAGAACCAGAGATCGCTGATCTATGCGTTCGTGTCTCGCGGCACAGTGATTCTCGCCGAGTACACCGAATTCAGCGGCAACTTTAACACAATCGCGTTCCAGTGCCTCCAGAAGCTCCCTGCCTCCAACAACAAGTTCACCTACAACTGCGACGGCCACACCTTCAACTACCTCGTCGACAACGAATTCACTTATTGTGTTGTTGCGGATGAATCGATTGGGAGACAGGTGCCTGTGGCTTTTCTGGAGCGTGCGAAGGATGATTTTGTGGCGAAATACGGTGGCGGGAAGGCCACGACTGCGGCCGCGAACAGCCTGAACAAAGAATTTGGGTCCAAGTTGAAGGAACATATGCAGTACTGTGTTGAGCACCCTGAAGAGATAAGCAAGCTTGCTAAGGTGAAAGCTCAGGTTTCTGAAGTTAAAGATGTCATGATGGAGAATATTGAAAAGGTTCTGGACAGGGGGGAAAAGATAGAGCTTCTGGTTGACAAAACTGAAAATCTTCATCACCAGGCACAAGACTTCAGGAATTCTGGGACCAAAATCCGTAGAAAAATGTGGCTGCAAAACATGAAGATAAAGCTGATTGTGTTGGCGATTTTGATAGCCCTGATCCTCATAATAGTTCTCTCTGTCTGCCGTGGGTTCAATTGTGGAAAATAA
Predicted protein sequences of Glyma07g34900
>Glyma07g34900.1   sequence type=predicted peptide   gene model=Glyma07g34900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQDQNQRSLIYAFVSRGTVILAEYTEFSGNFNTIAFQCLQKLPASNNKFTYNCDGHTFNYLVDNEFTYCVVADESIGRQVPVAFLERAKDDFVAKYGGGKATTAAANSLNKEFGSKLKEHMQYCVEHPEEISKLAKVKAQVSEVKDVMMENIEKVLDRGEKIELLVDKTENLHHQAQDFRNSGTKIRRKMWLQNMKIKLIVLAILIALILIIVLSVCRGFNCGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo