SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g34480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g34480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g34480

Feature Type:gene_model
Chromosome:Gm07
Start:39436803
stop:39438645
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g34480
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48590AT Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein | chr1:17962979-17964274 FORWARD LENGTH=169 SoyBaseE_val: 6.00E-65ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG1030 KOG Predicted Ca2+-dependent phospholipid-binding protein JGI ISS
PTHR26357Panther FAMILY NOT NAMED JGI ISS
PTHR26357:SF5Panther JGI ISS
PF00168PFAM C2 domain JGI ISS
UniRef100_G7JJZ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor GTPase-activating protein AGD12 n=2 Tax=Medicago truncatula RepID=G7JJZ3_MEDTR SoyBaseE_val: 2.00E-90ISS
UniRef100_I1KM70UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KM70_SOYBN SoyBaseE_val: 7.00E-121ISS

Expression Patterns of Glyma07g34480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g34480 not represented in the dataset
Glyma07g34480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g34480
ParalogEvidenceComments
Glyma20g02231 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g34480 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g219900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g34480
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g34480
>Glyma07g34480.1   sequence type=CDS   gene model=Glyma07g34480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAACATTCTGGGTCTCATCAAACTTCGTATCAAAAGAGGCACTAATCTCAAAGCTTGTGATACTCGTACCAGTGACCCATATGTCTTCGTCACCATGGCCGAACAGAAACTGAAAACTGGTGTTGTGAAAGATAACATTAATCCTGAGTGGAATGAAGAATTGACACTTTATGTAAGCGATGTTAACATTCCCGTACATCTGACAGTTTCAGACAAAGACACTTTCACCGTAGACGACAGCATGGGCGACGCAGAAATAGACCTAAAGCCGTATCTTCAGTGTGTAAAGATGAACTTGAGCGATCTTCCAGATGGCCATGTAATCAAGAGGGTTCAACCAGATAGGACTAACTGTCTTGCTGAAGAGAGCAACTGCATATGGAAGAATGGAAAAGTCACCCAAGAGATGAGTTTAAGATTGAGAAACGTCAAGTCTGGGGAAATAACTGTGGAAATTGAGTGGGTTAATCTTCCAGATTCAAAGGGCTTATCTGAAATTGAGTTTTAG
Predicted protein sequences of Glyma07g34480
>Glyma07g34480.1   sequence type=predicted peptide   gene model=Glyma07g34480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENILGLIKLRIKRGTNLKACDTRTSDPYVFVTMAEQKLKTGVVKDNINPEWNEELTLYVSDVNIPVHLTVSDKDTFTVDDSMGDAEIDLKPYLQCVKMNLSDLPDGHVIKRVQPDRTNCLAEESNCIWKNGKVTQEMSLRLRNVKSGEITVEIEWVNLPDSKGLSEIEF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo