SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g34150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g34150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g34150

Feature Type:gene_model
Chromosome:Gm07
Start:39062829
stop:39065892
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G37810AT Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 4;1 | chr5:15045232-15047807 FORWARD LENGTH=283 SoyBaseE_val: 2.00E-101ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF22Panther gb def: glycerol uptake facilitator protein [mycoplasma pulmonis] JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_B9HW70UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin, MIP family, NIP subfamily n=1 Tax=Populus trichocarpa RepID=B9HW70_POPTR SoyBaseE_val: 7.00E-111ISS
UniRef100_UPI000233864BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233864B related cluster n=1 Tax=unknown RepID=UPI000233864B SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g34150 not represented in the dataset

Glyma07g34150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g217700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g34150.1   sequence type=CDS   gene model=Glyma07g34150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAAAACGGAGGAAACATCCACGCTGATAGTACCTTTTGCGGTTCTCCTGCGGTAGTTCAAGTTATACAAAAGGTGATTGCAGAGTTGATAGGGACATATTTCTTAATATTTGCAGGGTGTTGTTCTGTGATTATTAATAACGCAGAAGAGACTAAAGGGAGAATTACCTTTCCTGGAATATGCCTAGTGTGGGGTTTCTCAGTGACTATCTTGGTTTATTCTCTTGCTCACGTTTCTGGTGCTCATTTCAATCCAGCGGTCACTCTTAGCTTTGCCATCTATCGCCATTTCCCTTTGAGACTGGTGCCTCTTTATTTTATTGCGCAAGTACTAGGATCTTTCCTTGCTAGTGGGACATTGTACCTTCTCTTTGAAGTAAACGAGAAAACTTACTTTGGAACAATACCATCAGGATCTTATATTCAATCTCTTGTTTTTGAGATACTTACGTCATTTCTCTTAATGTTTGTTGTGTGTGCAGTTTCCACGGACAATAGAGCGATTGGAAAATTGGGAGGGATTGCAGTTGGTATGACAATCATAGTAAACGTCTTCATTGCCGGACCAATCTCAGGAGCTTCCATGAACCCAGCTAGAAGCCTTGGACCAGCTTTGGTGATGTGGGTTTACAATGGAATTTGGATTTATGTAGTTGGACCATTTGTTGGTGCCATACTAGGTGCTACATGCTACAACTTGATTAGATATACTGACAAACCACTCAGAGAAATTGGTGCAAGCTCAAAAATATTTAAAACCAGTGCGTGTACAAGTGCTACATAA

>Glyma07g34150.1   sequence type=predicted peptide   gene model=Glyma07g34150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEENGGNIHADSTFCGSPAVVQVIQKVIAELIGTYFLIFAGCCSVIINNAEETKGRITFPGICLVWGFSVTILVYSLAHVSGAHFNPAVTLSFAIYRHFPLRLVPLYFIAQVLGSFLASGTLYLLFEVNEKTYFGTIPSGSYIQSLVFEILTSFLLMFVVCAVSTDNRAIGKLGGIAVGMTIIVNVFIAGPISGASMNPARSLGPALVMWVYNGIWIYVVGPFVGAILGATCYNLIRYTDKPLREIGASSKIFKTSACTSAT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo