Glyma07g33825 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g33825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g33825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g33825

Feature Type:	gene_model
Chromosome:	Gm07
Start:	38764272
stop:	38766750
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33825

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G29390	AT	Annotation by Michelle Graham. TAIR10: cold regulated 314 thylakoid membrane 2 \| chr1:10286409-10287668 REVERSE LENGTH=183	SoyBase	E_val: 7.00E-16	ISS
GO:0009631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cold acclimation	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0070417	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to cold	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0031357	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to chloroplast inner membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF05562	PFAM	Cold acclimation protein WCOR413	JGI		ISS
UniRef100_I1KSK8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSK8_SOYBN	SoyBase	E_val: 9.00E-20	ISS
UniRef100_Q84LB3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Truncated cold acclimation protein COR413-TM1 n=1 Tax=Zea mays RepID=Q84LB3_MAIZE	SoyBase	E_val: 2.00E-16	ISS

Expression Patterns of Glyma07g33825

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g33825 not represented in the dataset	Glyma07g33825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33825 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g215100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g33825

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33825

Limit To All Plant Sequences

>Glyma07g33825.1   sequence type=CDS   gene model=Glyma07g33825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAGTCCCTCCATCTCCGCTACCTCTCCGAACCCTTCCAAGAACCATCGCAACCAGAGGCGGGCTCTCCCACTTCCCTTGGCTTCAAGAACACTCATCTGTCAAGAACCACACGCGGAAGAGCTAGGAGAAGCCAGAAGAAGGAGAGTGGCGAGGGTGGATTGAAGTTGGAAGCGGAGAAAGACAATGGATTGGATAACTGTGCTCCGTCTGTGAGATACATTGTTCGTAGGCTCATTCGCGATGGATGTTCGAGAGGCACCGCAATGCCAAAATCGTATATTGTTCCGTTGTTTGCTGTGCAAGCACCTGTAGATGTCGTTTCCTGGATCAAAGGTAGATATGGTGAGTGGACAACATTCTTGGCACTTCTGATTCGTGTATTCTTCTATATTCCTGAGGCAGTATGGTAG

Predicted protein sequences of Glyma07g33825

Limit To All Plant Sequences

>Glyma07g33825.1   sequence type=predicted peptide   gene model=Glyma07g33825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKSLHLRYLSEPFQEPSQPEAGSPTSLGFKNTHLSRTTRGRARRSQKKESGEGGLKLEAEKDNGLDNCAPSVRYIVRRLIRDGCSRGTAMPKSYIVPLFAVQAPVDVVSWIKGRYGEWTTFLALLIRVFFYIPEAVW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain