|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G05170 | AT | Annotation by Michelle Graham. TAIR10: Cellulose synthase family protein | chr5:1530401-1535090 REVERSE LENGTH=1065 | SoyBase | E_val: 2.00E-18 | ISS |
GO:0000271 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process | SoyBase | N/A | ISS |
GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
GO:0006816 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion transport | SoyBase | N/A | ISS |
GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
GO:0006952 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response | SoyBase | N/A | ISS |
GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
GO:0007389 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pattern specification process | SoyBase | N/A | ISS |
GO:0008361 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell size | SoyBase | N/A | ISS |
GO:0009266 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
GO:0009809 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process | SoyBase | N/A | ISS |
GO:0009825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth | SoyBase | N/A | ISS |
GO:0009832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis | SoyBase | N/A | ISS |
GO:0009833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary cell wall biogenesis | SoyBase | N/A | ISS |
GO:0009834 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis | SoyBase | N/A | ISS |
GO:0009926 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin polar transport | SoyBase | N/A | ISS |
GO:0009932 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell tip growth | SoyBase | N/A | ISS |
GO:0010015 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root morphogenesis | SoyBase | N/A | ISS |
GO:0010817 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels | SoyBase | N/A | ISS |
GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
GO:0016126 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process | SoyBase | N/A | ISS |
GO:0030243 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process | SoyBase | N/A | ISS |
GO:0030244 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process | SoyBase | N/A | ISS |
GO:0040007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: growth | SoyBase | N/A | ISS |
GO:0042546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis | SoyBase | N/A | ISS |
GO:0043255 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of carbohydrate biosynthetic process | SoyBase | N/A | ISS |
GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
GO:0016757 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups | SoyBase | N/A | ISS |
GO:0016759 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity | SoyBase | N/A | ISS |
GO:0016760 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity | SoyBase | N/A | ISS |
PTHR13301 | Panther | X-BOX TRANSCRIPTION FACTOR-RELATED | JGI | ISS | |
PTHR13301:SF23 | Panther | JGI | ISS | ||
PF03552 | PFAM | Cellulose synthase | JGI | ISS | |
UniRef100_F6KQG5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase n=1 Tax=Populus tomentosa RepID=F6KQG5_POPTO | SoyBase | E_val: 2.00E-18 | ISS |
UniRef100_I1LDF0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDF0_SOYBN | SoyBase | E_val: 7.00E-19 | ISS |
Glyma07g33761 not represented in the dataset |
Glyma07g33761 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g33761.1 sequence type=CDS gene model=Glyma07g33761 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATACAAGTTTTCCTTGGTGAAAATGGTGTTCATGACATTGAAGGAAATGAATTACCTCGTCTTGTGTATGTGTCTTGTGAGAAAAGAGCTGGATATCATCACCACAAAAAAGGTGGACCTATGAATGCTTTGGTAGAGTGTCCTTCTAACTATAAAATTGAAAACTTTTTTAGTTTTCTTCTTTCTCCATCATCAGACCATTTTTGTAATGCTTTGTTGATTGATTGTGAAGGTGAGAGTATTGGCCTAAATGTTATGGATCTAAGACATGTAACTGTTGGCCTAAATGGTGGTGTTGTATGTGTTGTGGATCTAAGAAGAAAAAGATTAAAGCAAAGTCAAGTGTGA
>Glyma07g33761.1 sequence type=predicted peptide gene model=Glyma07g33761 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIQVFLGENGVHDIEGNELPRLVYVSCEKRAGYHHHKKGGPMNALVECPSNYKIENFFSFLLSPSSDHFCNALLIDCEGESIGLNVMDLRHVTVGLNGGVVCVVDLRRKRLKQSQV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||