SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33751

Feature Type:gene_model
Chromosome:Gm07
Start:38694183
stop:38697804
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g33751
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G67100AT Annotation by Michelle Graham. TAIR10: DNA-directed DNA polymerases | chr5:26776994-26785104 FORWARD LENGTH=1524 SoyBaseE_val: 1.00E-42ISS
GO:0000076GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication checkpoint SoyBaseN/AISS
GO:0000084GO-bp Annotation by Michelle Graham. GO Biological Process: S phase of mitotic cell cycle SoyBaseN/AISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0000731GO-bp Annotation by Michelle Graham. GO Biological Process: DNA synthesis involved in DNA repair SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0003002GO-bp Annotation by Michelle Graham. GO Biological Process: regionalization SoyBaseN/AISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006269GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication, synthesis of RNA primer SoyBaseN/AISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006271GO-bp Annotation by Michelle Graham. GO Biological Process: DNA strand elongation involved in DNA replication SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009910GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of flower development SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0033043GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of organelle organization SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: alpha DNA polymerase:primase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0001882GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003887GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity SoyBaseN/AISS
PF08996PFAM DNA Polymerase alpha zinc finger JGI ISS
UniRef100_I1J980UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase n=1 Tax=Glycine max RepID=I1J980_SOYBN SoyBaseE_val: 1.00E-63ISS
UniRef100_UPI00023370C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023370C8 related cluster n=1 Tax=unknown RepID=UPI00023370C8 SoyBaseE_val: 8.00E-84ISS

Expression Patterns of Glyma07g33751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g33751 not represented in the dataset
Glyma07g33751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33751 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g214500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g33751
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g33751
>Glyma07g33751.1   sequence type=CDS   gene model=Glyma07g33751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTTGCGTGTTGTGTGTTTTCTCAATAGAGAGATCGATATCTTGGTGCAATCCTGTTCGGGGTTTTTTAATAGGCTGAGTTTGTATCGAGGATGTGAGCCGCTGGTCTTGTCATACCCTAGCTACTCTGGTACATTTGACTACCCACCTATTTTTAAATCTATTTGTTTGTTGGGAAGTGAAAGGCAAAGACCAACCAATTTGTGCTATCCTAAATGCCCAGATGTTAAAATTTCTCCTGTAATGATAGCTAATCAGAGGTTTGTTTTAATGTACTACAGAGGTTTACTAGTGTGTGATGATGAAACATGTAAGCATACAATGCGAAGTATCAATCATCGGTTGGTTTGTGATTCTAAGAGAGGAACTGTTTGTCCAAATTATCCTCGCTACAATGGGCGTCTAGTTAGAAAGTACATAAAAGCAGACTTGTATAAGCTGTTCTCATATTTTTTCCATGTGTTCGATACTGTTTTTTGTATAGAAAAGATGAAGGCAAAATCTAGAATACCGATAGAGAAAGAGTTGATAAAAACTAGGGCGGTGATTAAATCGGCAGCATCAACAGCACAGGAGACCAAGATCGTTGCACCTTTGGGTGGGTGA
Predicted protein sequences of Glyma07g33751
>Glyma07g33751.1   sequence type=predicted peptide   gene model=Glyma07g33751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLRVVCFLNREIDILVQSCSGFFNRLSLYRGCEPLVLSYPSYSGTFDYPPIFKSICLLGSERQRPTNLCYPKCPDVKISPVMIANQRFVLMYYRGLLVCDDETCKHTMRSINHRLVCDSKRGTVCPNYPRYNGRLVRKYIKADLYKLFSYFFHVFDTVFCIEKMKAKSRIPIEKELIKTRAVIKSAASTAQETKIVAPLGG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo