Glyma07g33670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33670

Feature Type:	gene_model
Chromosome:	Gm07
Start:	38623800
stop:	38624006
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00480	AT	Annotation by Michelle Graham. TAIR10: ATP synthase subunit beta \| chrC:52660-54156 REVERSE LENGTH=498	SoyBase	E_val: 2.00E-36	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009817	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0015986	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport	SoyBase	N/A	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0046034	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP metabolic process	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005754	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial proton-transporting ATP synthase, catalytic core	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009544	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast ATP synthase complex	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0010287	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule	SoyBase	N/A	ISS
GO:0010319	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: stromule	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016469	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex	SoyBase	N/A	ISS
GO:0031977	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen	SoyBase	N/A	ISS
GO:0033178	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, catalytic domain	SoyBase	N/A	ISS
GO:0045261	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting ATP synthase complex, catalytic core F(1)	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0008553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
GO:0046933	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transporting ATP synthase activity, rotational mechanism	SoyBase	N/A	ISS
GO:0046961	GO-mf	Annotation by Michelle Graham. GO Molecular Function: proton-transporting ATPase activity, rotational mechanism	SoyBase	N/A	ISS
PTHR15184	Panther	ATP SYNTHASE	JGI		ISS
PTHR15184:SF23	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00006	PFAM	ATP synthase alpha/beta family, nucleotide-binding domain	JGI		ISS
UniRef100_A1BQG6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP synthase beta subunit (Fragment) n=1 Tax=Cucumis sativus RepID=A1BQG6_CUCSA	SoyBase	E_val: 2.00E-37	ISS
UniRef100_A1BQG6	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP synthase beta subunit (Fragment) n=1 Tax=Cucumis sativus RepID=A1BQG6_CUCSA	SoyBase	E_val: 2.00E-37	ISS

Expression Patterns of Glyma07g33670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma07g33670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33670

Limit To All Plant Sequences

>Glyma07g33670.1   sequence type=CDS   gene model=Glyma07g33670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TATGTACCTGCAGACGATTTAACTGATCATGCGCTTGCTACGACATTTGCACATTTAGATGCTACTATTGTACTATCAAGAGGATTAGCAGCCAAATGTATCTATCCAGCAGTAGATCCTTTAGATTCAACCTCAACTATGCTCCAACCTCGAATCGTTGGTGAAGAACATTATGAGACTGCGCAAAGAGTTAAACAAACTTTACAA

Predicted protein sequences of Glyma07g33670

Limit To All Plant Sequences

>Glyma07g33670.1   sequence type=predicted peptide   gene model=Glyma07g33670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YVPADDLTDHALATTFAHLDATIVLSRGLAAKCIYPAVDPLDSTSTMLQPRIVGEEHYETAQRVKQTLQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain