Glyma07g33550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33550

Feature Type:	gene_model
Chromosome:	Gm07
Start:	38457900
stop:	38458737
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G22100	AT	Annotation by Michelle Graham. TAIR10: RNA cyclase family protein \| chr5:7329015-7330718 FORWARD LENGTH=375	SoyBase	E_val: 8.00E-17	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0003963	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA-3'-phosphate cyclase activity	SoyBase	N/A	ISS
PTHR11096	Panther	RNA 3' TERMINAL PHOSPHATE CYCLASE	JGI		ISS
PF01137	PFAM	RNA 3'-terminal phosphate cyclase	JGI		ISS
UniRef100_B4FAC1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA 3-terminal phosphate cyclase-like protein n=2 Tax=Zea mays RepID=B4FAC1_MAIZE	SoyBase	E_val: 3.00E-17	ISS
UniRef100_UPI00023384CC	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023384CC related cluster n=1 Tax=unknown RepID=UPI00023384CC	SoyBase	E_val: 6.00E-34	ISS

Expression Patterns of Glyma07g33550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g212600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g33550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33550

Limit To All Plant Sequences

>Glyma07g33550.1   sequence type=CDS   gene model=Glyma07g33550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCAGAGGATGTTGGTGTGGGGATTGTTAATGCTTTACTAGGGAAGATAGCTCAAAGTGGAGTGGTAGATTCATCACATCAGGGTTTATTATTTCTTCTTTGTGCTCTATGCCCTCAAGATGTTTCCAAGGTCTGTGTAGGAAAACTTTCCCAGCATGGAGTCGAAACTCAAACATAA

Predicted protein sequences of Glyma07g33550

Limit To All Plant Sequences

>Glyma07g33550.1   sequence type=predicted peptide   gene model=Glyma07g33550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPEDVGVGIVNALLGKIAQSGVVDSSHQGLLFLLCALCPQDVSKVCVGKLSQHGVETQT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain