SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma07g33550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma07g33550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma07g33550

Feature Type:gene_model
Chromosome:Gm07
Start:38457900
stop:38458737
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G22100AT Annotation by Michelle Graham. TAIR10: RNA cyclase family protein | chr5:7329015-7330718 FORWARD LENGTH=375 SoyBaseE_val: 8.00E-17ISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003963GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA-3'-phosphate cyclase activity SoyBaseN/AISS
PTHR11096Panther RNA 3' TERMINAL PHOSPHATE CYCLASE JGI ISS
PF01137PFAM RNA 3'-terminal phosphate cyclase JGI ISS
UniRef100_B4FAC1UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA 3-terminal phosphate cyclase-like protein n=2 Tax=Zea mays RepID=B4FAC1_MAIZE SoyBaseE_val: 3.00E-17ISS
UniRef100_UPI00023384CCUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023384CC related cluster n=1 Tax=unknown RepID=UPI00023384CC SoyBaseE_val: 6.00E-34ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g33550 not represented in the dataset

Glyma07g33550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g212600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma07g33550.1   sequence type=CDS   gene model=Glyma07g33550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCCAGAGGATGTTGGTGTGGGGATTGTTAATGCTTTACTAGGGAAGATAGCTCAAAGTGGAGTGGTAGATTCATCACATCAGGGTTTATTATTTCTTCTTTGTGCTCTATGCCCTCAAGATGTTTCCAAGGTCTGTGTAGGAAAACTTTCCCAGCATGGAGTCGAAACTCAAACATAA

>Glyma07g33550.1   sequence type=predicted peptide   gene model=Glyma07g33550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPEDVGVGIVNALLGKIAQSGVVDSSHQGLLFLLCALCPQDVSKVCVGKLSQHGVETQT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo