Glyma07g33430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33430

Feature Type:	gene_model
Chromosome:	Gm07
Start:	38371605
stop:	38372770
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G34419	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G19200.1). \| chr4:16456597-16456986 FORWARD LENGTH=129	SoyBase	E_val: 5.00E-22	ISS
UniRef100_C6T4M2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4M2_SOYBN	SoyBase	E_val: 6.00E-94	ISS
UniRef100_Q9LJK8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Emb\|CAB36719.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LJK8_ARATH	SoyBase	E_val: 3.00E-11	ISS

Expression Patterns of Glyma07g33430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g33430

Paralog	Evidence	Comments
Glyma02g15030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g33430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g211700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g33430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33430

Limit To All Plant Sequences

>Glyma07g33430.1   sequence type=CDS   gene model=Glyma07g33430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCCCAGAATCTCCTTCTCTTATGATTTTGTGGTTTCCCAACAAGCAATAAAGCATGAAAATATATACAGAGAAGATCCCGTCTCTTCGGATTTCGAATTCTCTGTCAAGAACAATTCTATGATATCAGCAGATGAAGTCTTTTTCCAGGGTATGTTGTTGCCTCTGAAGAGTGATTGCTCCAATAAGAAGGTGACTTTGAGGGATGAGTTGCTTGTGAATGATGACTATGAAGAGGAGTTACCAAGAATACCAAAGAGTTCAAGCAGGTGGAAGCAGAGATTAGGCCTCAGGAGAGGTTCATCTAAGAAAGATAAGAATAAGAATAATGAGGGGTTTCAGCAGACTAGAGTTGATGATGAGAAAGGGTTCTGTTCTGGACAAGGAGACAAGACTGCTAGCTAA

Predicted protein sequences of Glyma07g33430

Limit To All Plant Sequences

>Glyma07g33430.1   sequence type=predicted peptide   gene model=Glyma07g33430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPRISFSYDFVVSQQAIKHENIYREDPVSSDFEFSVKNNSMISADEVFFQGMLLPLKSDCSNKKVTLRDELLVNDDYEEELPRIPKSSSRWKQRLGLRRGSSKKDKNKNNEGFQQTRVDDEKGFCSGQGDKTAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain