Report for Sequence Feature Glyma07g33210
Feature Type: gene_model
Chromosome: Gm07
Start: 38133849
stop: 38134680
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma07g33210
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G15780 AT
Annotation by Michelle Graham. TAIR10: Cupredoxin superfamily protein | chr2:6873666-6874701 REVERSE LENGTH=257
SoyBase E_val: 5.00E-43 ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005507 GO-mf
Annotation by Michelle Graham. GO Molecular Function: copper ion binding
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
PF02298 PFAM
Plastocyanin-like domain
JGI ISS
UniRef100_B6TG98 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Copper ion binding protein n=1 Tax=Zea mays RepID=B6TG98_MAIZE
SoyBase E_val: 5.00E-38 ISS
UniRef100_I1KLX6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KLX6_SOYBN
SoyBase E_val: 1.00E-84 ISS
Expression Patterns of Glyma07g33210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma07g33210 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.07g210300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma07g33210
Coding sequences of Glyma07g33210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma07g33210.2 sequence type=CDS gene model=Glyma07g33210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GAAATCATAGTTGGTGGTTCTGAGCATTGGCACTTTGGCTATAACTACACCAATTGGGCCATCAATAATGGCCCTTTCTATTTCAACGATACCCTAGTTTTCAAGTATGATGCTCCAAATGCGACTAGTTTTCCACACAGTGTGTACTTGTTAGCGAATTTTTGGAGCTTCTTGAATTGTGATGTTAAGAAGGCAAAGATGCTGGCGAACCCTAAGCAAGGTGCTGAAGAGGGCTTCAAGTTCGTGTTGAAGAAGTGGCAGCCATACTACTTTGCTTGTGGTGAGAGAAATGGATTTCATTGCAACAATGGACAGATGAAGTTCGCTGTTATTCCAATGCTTCGTCCCTTCTGGCCATGGCCATGA
Predicted protein sequences of Glyma07g33210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma07g33210.2 sequence type=predicted peptide gene model=Glyma07g33210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
EIIVGGSEHWHFGYNYTNWAINNGPFYFNDTLVFKYDAPNATSFPHSVYLLANFWSFLNCDVKKAKMLANPKQGAEEGFKFVLKKWQPYYFACGERNGFHCNNGQMKFAVIPMLRPFWPWP*