SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33081

Feature Type:gene_model
Chromosome:Gm07
Start:37973186
stop:37974927
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma07g33081
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G19010AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr3:6556306-6557862 REVERSE LENGTH=349 SoyBaseE_val: 2.00E-68ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0009963GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0045431GO-mf Annotation by Michelle Graham. GO Molecular Function: flavonol synthase activity SoyBaseN/AISS
KOG0143 KOG Iron/ascorbate family oxidoreductases JGI ISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PTHR10209:SF55Panther OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_A3QRM4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated nodulin 1A n=1 Tax=Glycine max RepID=A3QRM4_SOYBN SoyBaseE_val: 4.00E-120ISS
UniRef100_UPI0002338371UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338371 related cluster n=1 Tax=unknown RepID=UPI0002338371 SoyBaseE_val: 1.00E-166ISS

Expression Patterns of Glyma07g33081
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g33081 not represented in the dataset
Glyma07g33081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33081 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g209000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma07g33081
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma07g33081
>Glyma07g33081.1   sequence type=CDS   gene model=Glyma07g33081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGAGGTCGACCCAGCTTTCATCCAATACCTACAACACAGGCCAAAGTTCTCTACCATCCAACCTGAAGACATTCCTGTGATAGATATCTCCCCAATAACCAACCACACAGCTTCAGATCCATGTTCTATTGGAGGCTTAGTGAAGGAGATAAGAAATGCAAGCAAGGAGTGGGGTTTCTTCCAATTATCAAACCATGCTGTGCCCCTCACTCTAAGGCAAAACATTGAGAAAGCCTCAAGATTGTTCTTTACACAGAATTTGGAGGAGAAGAGGAAGGTTAGTAAAGATGAGAACAATACCACCGGTTACCATGACAGAGAGCACCCCAAGAACATTAGGGACTGGAAAGAAGTGGTTATAATACAAGAGTATATTCAAGAGATGGAAAAGCTGTGCTTTAAGCTGTTGGAGCTTATAGCTTTAAGCTTAGGTGTTGAAGCAAAGAGGTTTGAAGAACTTTTCATCAAAGATCAAACTAGTTCTATTCTACTCAACTGCTATCCTCCATGCCCTTACCCTCACCTTGCTCATGGCGTTGTGAAACCAACCCCAGATGCTTATACTATCAACTTTGGTGACATTATTCAGGTTTGGAGCAATGATGCATATGAGAGTGTGGAACACAGAGTGGTGGTCAACTCTGAGAAAGAAAGGTTCTCCATTCCATTCTTCTACCTTTCGCATGAAACTGAGGTCAAGCCTTTGGAGAAGCTGATAAATGAGCAAAACCCTTGA
Predicted protein sequences of Glyma07g33081
>Glyma07g33081.1   sequence type=predicted peptide   gene model=Glyma07g33081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEVDPAFIQYLQHRPKFSTIQPEDIPVIDISPITNHTASDPCSIGGLVKEIRNASKEWGFFQLSNHAVPLTLRQNIEKASRLFFTQNLEEKRKVSKDENNTTGYHDREHPKNIRDWKEVVIIQEYIQEMEKLCFKLLELIALSLGVEAKRFEELFIKDQTSSILLNCYPPCPYPHLAHGVVKPTPDAYTINFGDIIQVWSNDAYESVEHRVVVNSEKERFSIPFFYLSHETEVKPLEKLINEQNP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo