Glyma07g33070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33070

Feature Type:	gene_model
Chromosome:	Gm07
Start:	37969512
stop:	37971270
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G19000	AT	Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein \| chr3:6553668-6554987 REVERSE LENGTH=352	SoyBase	E_val: 1.00E-131	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016706	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors	SoyBase	N/A	ISS
KOG0143	KOG	Iron/ascorbate family oxidoreductases	JGI		ISS
PTHR10209	Panther	FE(II)/ ASCORBATE OXIDASE SUPERFAMILY	JGI		ISS
PF03171	PFAM	2OG-Fe(II) oxygenase superfamily	JGI		ISS
UniRef100_A3QRM2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated nodulin 1B n=1 Tax=Glycine max RepID=A3QRM2_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1KLW5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLW5_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma07g33070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma07g33070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g208900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g33070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33070

Limit To All Plant Sequences

>Glyma07g33070.1   sequence type=CDS   gene model=Glyma07g33070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGGTTGACCAAGCTTTCATCCAATACCCACAACACAGGCCAAATCTCACTATCATCCAACCTGAACACATTCCCATAATAGACCTCTCTCCAATAACCAACCACACAGTTTCACATCCATCTCCCATTGAAGGCTTGGTGAAGGAGATAGGAAATGCATGCAAAGAGTGGGGATTCTTCCAAGTTATCAACCATGGGGTGTCCCTCACTCTAAGGCAAAACATTGAGAAAGCCTCAAAATTGTTCTTTGCTCAGAGTTTAGAAGAGAAGAGGAAGGTTAGCAGAGATGAGAGTTCTCCCATGGGTTATTATGACACAGAGCACACAAAAAACATTAGGGACTGGAAAGAAGTGTTTGATTTTCTAGCCAAAGACCCTACTTTTGTTCCTCTCACTTCGGATGAACATGATAATCGTCTCACTCAATGGACTAATCCATCCCCTCAATACCCTCCACACTTCAGGGATATAATTAAAGAGTATGTTGAAGAGATGGAAAAGCTGTCCTTTAAGTTGATGGAGCTTATAGCTTTGAGTTTAGGCCTTGAGGCAAAGAGGTTTGAGGAATTTTTCATCAAAGATCAGACTAGCTTTCTTAGACTCAACTACTATCCTCCATGCCCTTACCCTCACCTTGCCCTTGGTGTTGGTCGACATAAGGACTCTGGTCCCTTAACCATTCTTGCACAAGATGAAGTTGGAGGACTTGAAGTGAGACCTAAAGCAGATCAAGACTGGATAAGAGTGAAACCTATTCCAAATGCTTATATTATCAACCTTGGTGATATGATTCAGGTTTGGAGCAATGATGCCTATGAGAGTGTGGAACACAGAGTGGTGGTCAACTCTGAGAAAGCAAGGTTTTCCATTCCATTCTTCCTCTTCCCTGCACATGACACTGTAGTCAAGCCTTTGGAGGAGCTAATAAATGAGCAAAACCCTTCAAAATTTAGGCCATACAAATGGGGCAAGTTTCTTGTCCACAGACTGGATAGCAATTTCAAGAAACAAAATGCGGAGAATGTTCAAACTTATCATTATAAGATAAGAGAGTAG

Predicted protein sequences of Glyma07g33070

Limit To All Plant Sequences

>Glyma07g33070.1   sequence type=predicted peptide   gene model=Glyma07g33070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKVDQAFIQYPQHRPNLTIIQPEHIPIIDLSPITNHTVSHPSPIEGLVKEIGNACKEWGFFQVINHGVSLTLRQNIEKASKLFFAQSLEEKRKVSRDESSPMGYYDTEHTKNIRDWKEVFDFLAKDPTFVPLTSDEHDNRLTQWTNPSPQYPPHFRDIIKEYVEEMEKLSFKLMELIALSLGLEAKRFEEFFIKDQTSFLRLNYYPPCPYPHLALGVGRHKDSGPLTILAQDEVGGLEVRPKADQDWIRVKPIPNAYIINLGDMIQVWSNDAYESVEHRVVVNSEKARFSIPFFLFPAHDTVVKPLEELINEQNPSKFRPYKWGKFLVHRLDSNFKKQNAENVQTYHYKIRE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain