Glyma07g33031 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g33031

Feature Type:	gene_model
Chromosome:	Gm07
Start:	37913269
stop:	37914508
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g33031

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37110	AT	Annotation by Michelle Graham. TAIR10: Zinc-finger domain of monoamine-oxidase A repressor R1 \| chr4:17484343-17486197 REVERSE LENGTH=417	SoyBase	E_val: 2.00E-23	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
UniRef100_G7JNK7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cell division cycle-associated 7-like protein n=1 Tax=Medicago truncatula RepID=G7JNK7_MEDTR	SoyBase	E_val: 2.00E-32	ISS
UniRef100_I1JEY9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JEY9_SOYBN	SoyBase	E_val: 8.00E-48	ISS

Expression Patterns of Glyma07g33031

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma07g33031 not represented in the dataset	Glyma07g33031 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g33031

Paralog	Evidence	Comments
Glyma02g15460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g33031 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g208500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g33031

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g33031

Limit To All Plant Sequences

>Glyma07g33031.1   sequence type=CDS   gene model=Glyma07g33031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCTGGTACTAATTAACTATGCTGAGAGACCTCTTCGTGAGTCAGCAAGTAAAGAAAAAGATGAAGTAGATATTGTTATACCAGAAGGTACAAACCCGGAAGTTTACACTGAAGAGCAGGAGAAGCTTCTGGGAGACTGTGAGAGTACTTGGGAATTGTATGTAGATGGATATGATGAAGATGGGAACCGTATATATGATCCAATCAAAGGAGAGGCATGTCATCAATGCAGATATGGAGAAAATGTGGTAGAAGTCCACCATAACACAAAATGGACTTGCCTCCTTGTCGGGATATTTGCCACTACAGTCCTTGCCGCAGGGGAAAAGGTTGGATGTCTACTGGCAAAATATACAGTAGGTTAG

Predicted protein sequences of Glyma07g33031

Limit To All Plant Sequences

>Glyma07g33031.1   sequence type=predicted peptide   gene model=Glyma07g33031   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLVLINYAERPLRESASKEKDEVDIVIPEGTNPEVYTEEQEKLLGDCESTWELYVDGYDEDGNRIYDPIKGEACHQCRYGENVVEVHHNTKWTCLLVGIFATTVLAAGEKVGCLLAKYTVG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain