Glyma07g32250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma07g32250

Feature Type:	gene_model
Chromosome:	Gm07
Start:	37168924
stop:	37172987
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma07g32250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G28500	AT	Annotation by Michelle Graham. TAIR10: NAC domain containing protein 73 \| chr4:14083014-14084266 FORWARD LENGTH=305	SoyBase	E_val: 9.00E-123	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:2000652	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of secondary cell wall biogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_B9RB87	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain-containing protein 21/22, putative n=1 Tax=Ricinus communis RepID=B9RB87_RICCO	SoyBase	E_val: 3.00E-156	ISS
UniRef100_I1KLQ2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLQ2_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma07g32250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma07g32250

Paralog	Evidence	Comments
Glyma13g24320	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma07g32250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g201800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma07g32250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma07g32250

Limit To All Plant Sequences

>Glyma07g32250.1   sequence type=CDS   gene model=Glyma07g32250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATGGTGCAATGACTCAGATGAGGAGAGGGGAATTGATCAACTGGTTGCACCAACAATTACTCCTACTTCAACTAATAACACTACTGTTCTTACTGATCATCGCACAAAAGCAAGCGAAATTCGCACCTTAACTTGCCCCTCATGTGGCCAAAACATTGAATTCCAAGACCAGACTGGAATCAATGACTTGCCGGGGTTACCAGCTGGGGTGAAGTTTGATCCGAATGACCAAGAGATATTAGAGCATTTGGAAGCAAAGGTACTGTCTGACGTGCCAAAGCTTCATCCACTTATTGATGAGTTCATACCAACGCTTGAAGGAGAGAATGGGATCTGTTATACGCATCCAGAAAAGCTTCCAGGTGTAAGAAAAGATGGACAAATCCGCCACTTCTTTCACAGGCCATCTAAAGCATACACAACAGGAACAAGGAAAAGAAGAAAGGTTCACACCGACGAAGAAGGAAGCGAGACAAGGTGGCACAAAACAGGAAAAACTAGACCCGTTTTTGTTGGTGGTGCTGTGAAGGGGTTCAAGAAAATCCTAGTCCTCTACACCAACTATGGAAGGCAAAAGAAGCCTGAGAAGACCAATTGGGTGATGCATCAATACCACCTTGGCACTAGCGAAGAAGAGAAAGATGGAGAATTGGTGGTTTCAAAGGTTTTCTACCAAACACAACCTCGACAATGTGGTAATTCCATTATAAAGCAGGATCTTTATGATGAAGAAAGATTGATGACTAACCAAAGTGTCCATAATGATGATGACAACAATATAATACCTAGAAATAATAATGCAAGTGCTCTTATGGACTACTACAATCCTTCTTTCATAAATTATGACCAATTGGGTGGTCGTAGTAATAGGGAAAATTCACCTCAACTTATTCCAAATTTGGTCATGCAAGGTGATAGCTCTTCTTTCATTCGATTAGCAATGGATGCAACCAAAGCCAAGATGGACAGAAAATAG

Predicted protein sequences of Glyma07g32250

Limit To All Plant Sequences

>Glyma07g32250.1   sequence type=predicted peptide   gene model=Glyma07g32250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTWCNDSDEERGIDQLVAPTITPTSTNNTTVLTDHRTKASEIRTLTCPSCGQNIEFQDQTGINDLPGLPAGVKFDPNDQEILEHLEAKVLSDVPKLHPLIDEFIPTLEGENGICYTHPEKLPGVRKDGQIRHFFHRPSKAYTTGTRKRRKVHTDEEGSETRWHKTGKTRPVFVGGAVKGFKKILVLYTNYGRQKKPEKTNWVMHQYHLGTSEEEKDGELVVSKVFYQTQPRQCGNSIIKQDLYDEERLMTNQSVHNDDDNNIIPRNNNASALMDYYNPSFINYDQLGGRSNRENSPQLIPNLVMQGDSSSFIRLAMDATKAKMDRK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain