|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G25910 | AT | Annotation by Michelle Graham. TAIR10: 3'-5' exonuclease domain-containing protein / K homology domain-containing protein / KH domain-containing protein | chr2:11049379-11051997 REVERSE LENGTH=341 | SoyBase | E_val: 2.00E-12 | ISS |
GO:0006139 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process | SoyBase | N/A | ISS |
GO:0006623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole | SoyBase | N/A | ISS |
GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
GO:0008408 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity | SoyBase | N/A | ISS |
UniRef100_I1MXE6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXE6_SOYBN | SoyBase | E_val: 4.00E-11 | ISS |
UniRef100_O82306 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 3'-5' exonuclease and KH-I domain-containing protein n=1 Tax=Arabidopsis thaliana RepID=O82306_ARATH | SoyBase | E_val: 1.00E-09 | ISS |
Glyma07g32160 not represented in the dataset |
Glyma07g32160 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma07g32160.1 sequence type=CDS gene model=Glyma07g32160 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACCCTAAATTACAAATCCCAATTCAAATCACAAATCACAACCCCAAATCACAAATTGAGTCGAAGTTGGTCATTGATTCACGATTGCAAACGCGACAAGGAGGCGTTGTGCTTTCAGTTCAACATCAAGTTGAACAACGTGGTGGACACGCAAATTGCTAATTCGCTCATAGAGGGCAAGGTCGAAAGAGAACGAGGTTGGGGAATCATAGGGTATGGAAAACCAGACCAATTAAGAGGAGGAAGGCCTGGCCGAGTAATTATGCGTGAATTGTGGAGTGGGTGG
>Glyma07g32160.1 sequence type=predicted peptide gene model=Glyma07g32160 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TLNYKSQFKSQITTPNHKLSRSWSLIHDCKRDKEALCFQFNIKLNNVVDTQIANSLIEGKVERERGWGIIGYGKPDQLRGGRPGRVIMRELWSGW
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||